Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052374 (Actn2)
Chromosomal location
Chr 13: 12361696 - 12432999 (-)
Description
actinin alpha 2 Gene [Source:MGI (curated);Acc:Actn2-001]
RefSeq_dna
NM_033268 
RefSeq_peptide
NP_150371.4 
UniGene
Mm.37638 Mm.467850 
MGI
MGI:109192 
Uniprot/SWISSPROT
Q9JI91 
Uniprot/SPTREMBL
Q5FW75 Q8K3Q4 Q9CTH3 
Human Ortholog
ENSG00000077522 (ACTN2)
Omim 612158 - CARDIOMYOPATHY, DILATED, 1AA  
UniTrap UNI32988
Vector Insertion
Chr 13: 12403113 - 12433000
Public Clones IST14906C9 (tigm) IST10078H12 (tigm) IST14595E8 (tigm) IST14551E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32757
Vector Insertion
Chr 13: 12401861 - 12403229
Public Clones IST12504A4 (tigm) IST10077A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27501
Vector Insertion
Chr 13: 12401254 - 12401861
Public Clones IST11369E10 (tigm) IST11081D3 (tigm) IST12100B4 (tigm) IST10922H2 (tigm)
IST10986G6 (tigm) IST13640H3 (tigm) IST10345A11 (tigm) IST10259D10 (tigm)
IST11064F9 (tigm) IST12504A4 (tigm) IST11459F9 (tigm)
Private Clones OST57986 (lexicon)
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16260
Vector Insertion
Chr 13: 12398629 - 12401166
Public Clones IST13931B7 (tigm)
Private Clones OST464414 (lexicon) OST455157 (lexicon) OST440995 (lexicon) OST342360 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34368
Vector Insertion
Chr 13: 12388741 - 12393284
Public Clones IST11541G1 (tigm) IST12366C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21759
Vector Insertion
Chr 13: 12386670 - 12388741
Public Clones not available
Private Clones OST318676 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28777
Vector Insertion
Chr 13: 12363204 - 12364965
Public Clones not available
Private Clones OST20835 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110616
Sequence
GTGCTGGTACTTCGCCGGAGACTCCGCGCCCAGGCGTGCCGCCCCAGGAACCGCGAGAAGGTCACCGCAGCCCGCCGCCTTTCCATCCATCCATCCATCC

ATCCATCCATCCATCCATCCATCCATCCATTCATCCATCCATCCATCCATCCATCCATCCATCCATTTCTCCGTCCGTCTGTCCATCCCTTGCGCTGTGC

TCGCTCCCCAGCCGCCCCAGCCACCCAGCGCCATGAATCAGATAGAGCCCGGCGTGCAGTACAACTATGTCTACGACGAAGATGAGTATATGATCCAGGA

GGAGGAGTGGGACCGCGACCTGCTCCTCGACCCGGCCTGGGAGAAGCAGCAGAGGAAG - UNI32757 - - UNI32988 - ACGTTCACTGCCTGG

TGCAACTCACACCTGCGGAAAGCTGGCACCCAGATCGAGAACATCGAGGAGGATTTCAGGAACGGCCTCAAGCTCATGCTACTTCTAGAAGTCATCTCAG

 - UNI32757 - - UNI32988 - GGGAAAGGCTGCCCAAACCTGACCGGGGAAAAATGCGGTTCCACAAGATTGCGAATGTCAACAAGGCTCTGGA

TTACATAGCCAGCAAGGGAGTGAAGCTGGTATCTATTGGAGCTGAAG - UNI27501 - - UNI32757 - AAATAGTCGATGGCAATGTGAAGATG

ACCCTGGGTATGATCTGGACCATCATCCTCCGCTTCGCCATTCAGGACATCTCAGTGGAAGGTAAAGTTCATGGGGGTGGTCCACGTGTCTAATTTGGGA

ACTGAGCTTACAAATTAGATCTTGAATCGGATATTGTGACACTGAGCAGTCACTTGCACGATCAAACGGGAGGCATCTAAATTGAGTCTTTAAAATTTTT

ATATTTGTATGGGAAAAGACCGAGGCAGTGCTATTCTATTCTTGCGGTGGAATCGCTTTGCAAGAGATGCACACATGTCTGGAGCAGACGGTGTTTTTAA

CATAAGTTTCTTTACTGCATATTGTACTAGGGCGTTCACAAATGTGCTAATGCAATAGGCAGAGGGTTTTCTTTCTCCTTTGTATTCTCTATCCTTCCCT

CCTCTCTCCCCTGTCCCTCCCTCCCTATTTCTTCTTCCTTCTCTTTCTCTCTTCACTGGGGATTAAAACAGGGCCTTGCAATTGCTAAACACGTGTCACC

ACAGAGTCATCCCTTCAGTTCCCTCGGGCAAAGATCATTAGGCTTACAGCTAGAACACTTTAGTAGTATTTAGTAATATTAATAATAAAAGTTGGGTGTG

GTGGTTGACACCTATCAACCTAGCATTCAGGAAGCTAAGACAGGAGGATCACAAATTTGAAAGCCCCTCAGGCTTTGTAGCCAGCCCACCCAAGCCTGTG

TAACCCCTGTTTCACCCCTAAAGCATTCTTTACATTCCTTCC
Translation
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRK - UNI32757 - - UNI32988 - TFTAWCNSHLRKAGTQIENIEEDFRNGLKLM

LLLEVISG - UNI32757 - - UNI32988 - GERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEE - UNI27501 - - UNI32757

 - EIVDGNVKMTLGMIWTIILRFAIQDISVEGKVHGGGPRV
Transcript ENSMUST00000064204
Sequence
GTGCTGGTACTTCGCCGGAGACTCCGCGCCCAGGCGTGCCGCCCCAGGAACCGCGAGAAGGTCACCGCAGCCCGCCGCCTTTCCATCCATCCATCCATCC

ATCCATCCATCCATCCATCCATCCATCCATTCATCCATCCATCCATCCATCCATCCATCCATCCATTTCTCCGTCCGTCTGTCCATCCCTTGCGCTGTGC

TCGCTCCCCAGCCGCCCCAGCCACCCAGCGCCATGAATCAGATAGAGCCCGGCGTGCAGTACAACTATGTCTACGACGAAGATGAGTATATGATCCAGGA

GGAGGAGTGGGACCGCGACCTGCTCCTCGACCCGGCCTGGGAGAAGCAGCAGAGGAAG - UNI32757 - - UNI32988 - ACGTTCACTGCCTGG

TGCAACTCACACCTGCGGAAAGCTGGCACCCAGATCGAGAACATCGAGGAGGATTTCAGGAACGGCCTCAAGCTCATGCTACTTCTAGAAGTCATCTCAG

 - UNI32757 - - UNI32988 - GGGAAAGGCTGCCCAAACCTGACCGGGGAAAAATGCGGTTCCACAAGATTGCGAATGTCAACAAGGCTCTGGA

TTACATAGCCAGCAAGGGAGTGAAGCTGGTATCTATTGGAGCTGAAG - UNI27501 - - UNI32757 - AAATAGTCGATGGCAATGTGAAGATG

ACCCTGGGTATGATCTGGACCATCATCCTCCGCTTCGCCATTCAGGACATCTCAGTGGAAG - UNI16260 - AAACATCTGCCAAAGAAGGGCTGCT

GCTATGGTGTCAGAGGAAGACAGCTCCATACAGAAATGTGAATATCCAGAACTTCCACACCAG CTGGAAAGATGGCCTTGGACTCTGTGCCCTCATCCA

CAGACACCGGCCCGACCTCATTGACTACTCAAAGCTTAACAAG - UNI34368 - GATGACCCCATAGGAAACATTAACCTGGCCATGGAAATAGCAG

AGAAGCACTTGGATATCCCTAAGATGTTGGATGCTGAAG - UNI34368 - ACATTGTCAACACTCCCAAACCCGATGAAAGAGCCATCATGACTTAC

GTTTCCTGCTTCTACCATGCTTTCGCGGGAGCGGAGCAG - UNI21759 - - UNI34368 - GCCGAGACAGCAGCTAACAGAATATGTAAGGTTC

TTGCTGTGAATCAAGAGAATGAGAGGCTGATGGAAGAATATGAGAGGCTAGCGAGTGAG CTGTTGGAGTGGATTCGGCGCACAATCCCCTGGCTGGAGA

ACAGGACGCCTGAGAAGACCATGCAGGCCATGCAGAAGAAGCTGGAGGACTTCCGGGATTACCGTCGTAAGCATAAGCCCCCCAAGGTGCAGGAGAAGTG

CCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTTCGGATCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAGATGGTGTCG GACATTGC

TGGTGCCTGGCAGAGGTTGGAGCAGGCTGAGAAGGGCTATGAGGAGTGGCTATTGAATGAGATTCGAAGACTGGAGCGCTTGGAGCACTTGGCTGAGAAG

TTCAGGCAGAAGGCCTCCACGCACGAGACATGGGCTTATG GCAAAGAACAGATCTTGCTGCAGAAGGACTACGAGTCTGCGTCCCTGACGGAAGTTCGA

GCCCTACTTCGGAAGCACGAGGCCTTTGAGAGCGACCTGGCTGCACACCAGGACCGCGTGGAGCAGATCGCTGCCATTGCGCAGGAGCTCAA TGAACTG

GACTATCACGATGCTGTGAACGTCAATGATCGGTGCCAGAAAATTTGCGACCAGTGGGATAGATTGGGGACGCTCACCCAGAAGAGGAGGGAGGCCTTGG

AG AGAACTGAGAAGTTGCTGGAAACAATCGACCAACTGCACCTGGAGTTTGCCAAGAGAGCCGCGCCCTTCAACAACTGGATGGAGGGAGCCATGGAGG

ACCTGCAGGACATGTTCATTGTCCACAGCATCGAGGAGATCCAG AGTCTGATCACTGCACATGAGCAGTTCAAGGCCACACTGCCCGAGGCCGACGGGG

AGCGGCAGTCCATCCTGGCCATCCAGAACGAGGTGGAGAAGGTGATCCAGAGCTACAGCATCCGGATCAGCTCCAGCAACCCCTACAGCACTGTCACCAT

GGATGAGCTGCGCAACAAGTGGGACAAG GTGAAGCAGCTGGTGCCGGTCCGGGATCAGTCCCTGCAGGAGGAGCTGGCTCGCCAACATGCTAATGAGCG

TCTGCGGCGCCAGTTTGCTGCTCAGGCCAATGCCATTGGGCCCTGGATCCAGAACAAGATGGAG GAGATCGCTCGGAGCTCCATCCAGATCACCGGGGC

CCTGGAGGACCAGATGAACCAGCTGAAGCAGTACGAACACAACATCATCAACTACAAGAACAACATCGACAAGCTGGAGGGCGACCACCAGCTCATCCAG

GAGGCCCTGGTCTTCGACAACAAGCACACGAACTACACCATGGAG CATATCCGTGTCGGATGGGAGTTGCTGCTGACAACTATCGCCAGAACCATCAAT

GAGGTGGAGACCCAGATCCTGACAAGAGATGCCAAGGGCATCACCCAGGAGCAGATGAATGAGTTCAGAGCCTCCTTCAACCACTTTGACAGG AGGAAG

AACGGCCTGATGGATCATGAGGATTTCAGAGCCTGCCTCATTTCCATGGGCTATGACTTG - UNI28777 - GGTGAAGCTGAATTTGCCCGCATTAT

GACTTTGGTTGACCCCAACGGACAAGGCACGGTCACCTTCCAGTCCTTCATTGACTTCATGACTAGAGAGACCGCAGACACCGACACGGCAGAGCAGGTC

ATCGCCTCCTTCCGGATTCTGGCTTCTGATAAG CCTTACATCTTGGCAGAGGAGCTTCGTCGAGAGCTGCCTCCGGATCAGGCCCAGTACTGCATCAAG

AGAATGCCCCCATACTCAGGCCCGGGCAGTGTCCCCGGGGCCCTGGACTACACTGCCTTCTCCTCTGCCCTCTACGGGGAAAGCGACCTCTAATGCTCTT

TCTGTAATCCCTACCCTATCAGAATGCAATAAAGGCTGAAGTATAGGCTGTTACCTGG
Translation
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRK - UNI32757 - - UNI32988 - TFTAWCNSHLRKAGTQIENIEEDFRNGLKLM

LLLEVISG - UNI32757 - - UNI32988 - GERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEE - UNI27501 - - UNI32757

 - EIVDGNVKMTLGMIWTIILRFAIQDISVEE - UNI16260 - ETSAKEGLLLWCQRKTAPYRNVNIQNFHTS SWKDGLGLCALIHRHRPDLIDY

SKLNK - UNI34368 - DDPIGNINLAMEIAEKHLDIPKMLDAED - UNI34368 - DIVNTPKPDERAIMTYVSCFYHAFAGAEQ - UNI2175

9 - - UNI34368 - AETAANRICKVLAVNQENERLMEEYERLASE LLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEI

NFNTLQTKLRISNRPAFMPSEGKMVS DIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYG GKEQILLQKDYESASLTEVRAL

LRKHEAFESDLAAHQDRVEQIAAIAQELN NELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALE RTEKLLETIDQLHLEFAKRAAPFNNWMEGAME

DLQDMFIVHSIEEIQ SLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSSNPYSTVTMDELRNKWDK VKQLVPVRDQSLQEELARQHAN

ERLRRQFAAQANAIGPWIQNKME EIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTME HIRVGWELLLTTIAR

TINEVETQILTRDAKGITQEQMNEFRASFNHFDR RKNGLMDHEDFRACLISMGYDL - UNI28777 - GEAEFARIMTLVDPNGQGTVTFQSFIDFM

TRETADTDTAEQVIASFRILASDK PYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL

For any suggestions or comments, please send an email to unitrap@crg.es