Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052406 (Rexo4)
Chromosomal location
Chr 2: 26809083 - 26819906 (-)
Description
REX4, RNA exonuclease 4 homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Rexo4-001]
RefSeq_dna
NM_207234 
RefSeq_peptide
NP_997117.2 
UniGene
Mm.291874 
MGI
MGI:2684957 
Uniprot/SWISSPROT
Q6PAQ4 
Uniprot/SPTREMBL
A2ALB2 A2ALB1 
Human Ortholog
ENSG00000148300 (REXO4)
Omim not available
UniTrap UNI7284
Vector Insertion
Chr 2: 26819571 - 26819839
Public Clones RRT374 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25898
Vector Insertion
Chr 2: 26819571 - 26819833
Public Clones not available
Private Clones OST153522 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1596
Vector Insertion
Chr 2: 26818244 - 26819571
Public Clones CC0016 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064244
Sequence
GCAGGTCGCGAAGAGAACAGCAACCCGGGTTCCCGCATGCGCAGTGGAGCACGCTTGCACCCTGGGAAATGTGTGCTTGCGCGGTTGCTGGAGTCGCGGT

CTCTTCCCTGGTGGTTCCGACTGCGGAGAGCGGGGAGATGAAGACGAAGGCCACCGCGCCGGTGCCCCAACCTGGGCCTATCAGGAAGCTCGCTAGGAAG

AAAGCCAAGAAGAAGTTCAGGAAGAGCAAAGCTCTGGCAGGAAGTGGGGTTCCGGGAAGCCACCCGGCGGCTGTGGCAGGCCGACCGCCGAAGGCCCCCG

AGAACTTTTCTCAAAATTGGAAGGCGTTGCAAGAG - UNI1596 - - UNI7284 - - UNI25898 - CTACTGAAACAAAAGTCACAGGCCGCA

GAAAAACCTCTTGTCTCTCAGATGGATGACAAAATGCACCCCCAAATAATCCAGCAGAACAGAAAAAAGGCCTCAGATAAATCAAAGGGAGACAAGCAGA

GGACAGAAAAGGCCAAGAGCACTAGGGGTTCTGTTACATCTGCACCTACGGACAGGAAGATACTAGTACCTCCCACAGATACCTCTGGAACAGAGCAGAA

GAAAGGAGCCAAGAAGAGGACATATAGTGACATCTCTTCTCATCAAGGGGCTCTCAAGCCTAAGTGGAAAGCTACGGAGGCAGCTGTTATCTTGAATCAG

CCCACGCCCACTGA GGAAGACATCTGGTTTGATGATGTGGATCCAGATGATATTGAGGATGCCATAGGCCCAGAGGCAGCCATGCTGGTACGGAAGAGG

CTGGGGCAGAAGAAGAGGACCATCTCCCTGGAGAAGGAACAAGCCTTTGGCGG CTTGACAAAAGCCTTGGCCCTGGATTGTGAGATGGTAGGCGTGGGT

CCCAAAGGGGAAGAGAGCATCGCAGCCCGTGTGTCGATCGTGAACCAGTATGGGAAGTGTGTTTATGACAAGTACGTCAAGCCAACTGAGCCAGTGACTG

ACTACAGGACAGCCGTCAGTGGGATCCGGCCTGAGAACCTGAAGCAGG GAGAAGAGTTTGAAGTTGTGAAGAAGGAAGTGGCAGAAATGTTGAAGGGCA

GAATCCTGGTGGGGCATGCGCTACACAATGATTTAAAG GTTTTGTTCCTTGACCATCCAAAAAAGAAAATCAGGGACACTCAGAAATTCAAACCATTCA

GGAGTCGAGTAAAG AGTGGACGACCGTCTCTGAAACGGCTTTCTGAGAAAATTCTGGGGATCAGGGTCCAACAGGCCGAGCACTGCTCA ATCCAGGAT

GCCCAGGCAGCAATGAGGCTTTACGTCATGGTGAAACGGGAATGGGAGAGCAGTACTGCAAACCGGCGTGCCCCAGCTGCCACTCCACAGCACCGCATCA

AGAACTCTTAGCACCATCCTACTGCTGTCGCCACCACCCTGTCCGTCAGAGACTTCTCAATCCAGTGGCAGTTGGGATGGGGTTATGAGGCCTGTCAGGT

CTATGCACAGCAGGGACTCTGTCTTTGGTGAGCTTTCTCAGAGCCATGGCTGCAGGCATGTGAGCTGCGGGAACTTCCTCCTGAACTACCCAGGGCCTAA

TCATCCAGCACCTGTGTGTTGAGGTAGACTGGTCAGATACAGGGCAGAAGTCAGGGGTGTAGGTTCGAGGAAGGAGAACATCATTGGAATGGAGGAGAGT

GCTGCAGAGTCTATGTCTGCTGACCACCTGTGCTACCACTTAACAATGAGCATAGCTGGTCTCAGCCAGGGCACTCAGCACCTTCCCTTAAGGAGCAAGA

AGCGCCTTCTCTGTCAGGTAAGGGGATAAGCTCTGCTGGATCCAAGGGATCCAGGCTAAGGGCGTTCAGTCTGCTGCAAACCAGTCTGGCCAGCACAGCA

ACCGCCCATTGAGGACTTTCTTAAAGCTACTGGGCTGGAGGTCCTTTCCCACTCCTTTGTCCTTTGCTTGGCCTAAGATGCCAATGCCCCGCCATGTTTT

CTCCAGAGAGTCCTTGGGGTGAGCCTTGGGGCACAGGTACACTCAGAGGTCTGAGAGCCTACCATGTGGAACAGTGTAAGCAGAAAGGCCATCTTCCCAC

TGTCCTGCCAGCAGCTGTTCTGGGTAGCAGCAATTGCAGAGTGACCAGTGAACTTTATGGACTTAGCTGACAACTCCTAGAACATGTGCACCCATGCATA

TGATGACAGATGTCTGCTTTTAATGCAGCTGTGGACTGAGGTGTGGCTCAGAGGACACTTGTTCACTAAGTGTAAGACCCTGGTATCCTTTCCTAGAACT

GTCAAAAATAAATGGATGGATCAAA
Translation
MKTKATAPVPQPGPIRKLARKKAKKKFRKSKALAGSGVPGSHPAAVAGRPPKAPENFSQNWKALQE - UNI1596 - - UNI7284 - - UNI2589

8 - LLKQKSQAAEKPLVSQMDDKMHPQIIQQNRKKASDKSKGDKQRTEKAKSTRGSVTSAPTDRKILVPPTDTSGTEQKKGAKKRTYSDISSHQGALKP

KWKATEAAVILNQPTPTE EEDIWFDDVDPDDIEDAIGPEAAMLVRKRLGQKKRTISLEKEQAFGG GLTKALALDCEMVGVGPKGEESIAARVSIVNQY

GKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQG GEEFEVVKKEVAEMLKGRILVGHALHNDLK VLFLDHPKKKIRDTQKFKPFRSRVK SGRPSLKRL

SEKILGIRVQQAEHCS IQDAQAAMRLYVMVKREWESSTANRRAPAATPQHRIKNS
Transcript ENSMUST00000114020
Sequence
ATGTGTGCTTGCGCGGTTGCTGGAGTCGCGGTCTCTTCCCTGGTGGTTCCGACTGCGGAGAGCGGGGAGATGAAGACGAAGGCCACCGCGCCGGTGCCCC

AACCTGGGCCTATCAGGAAGCTCGCTAGGAAGAAAGCCAAGAAGAAGTTCAGGAAGAGCAAAGCTCTGGCAGGAAGTGGGGTTCCGGGAAGCCACCCGGC

GGCTGTGGCAGGCCGACCGCCGAAGGCCCCCGAGAACTTTTCTCAAAATTGGAAGGCGTTGCAAGAG - UNI1596 - - UNI7284 - - UNI258

98 - CTACTGAAACAAAAGTCACAGGCCGCAGAAAAACCTCTTGTCTCTCAGATGGATGACAAAATGCACCCCCAAATAATCCAGCAGAACAGAAAAAA

GGCCTCAGATAAATCAAAGGGAGACAAGCAGAGGACAGAAAAGGCCAAGAGCACTAGGGGTTCTGTTACATCTGCACCTACGGACAGGAAGATACTAGTA

CCTCCCACAGATACCTCTGGAACAGAGCAGAAGAAAGGAGCCAAGAAGAGGACATATAGTGACATCTCTTCTCATCAAGGGGCTCTCAAGCCTAAGTGGA

AAGCTACGGAGGCAGCTGTTATCTTGAATCAGCCCACGCCCACTGA GGAAGACATCTGGTTTGATGATGTGGATCCAGATGATATTGAGGATGCCATAG

GCCCAGAGGCAGCCATGCTGGTACGGAAGAGGCTGGGGCAGAAGAAGAGGACCATCTCCCTGGAGAAGGAACAAGCCTTTGGCGG CTTGACAAAAGCCT

TGGCCCTGGATTGTGAGATGGTAGGCGTGGGTCCCAAAGGGGAAGAGAGCATCGCAGCCCGTGTGTCGATCGTGAACCAGTATGGGAAGTGTGTTTATGA

CAAGTACGTCAAGCCAACTGAGCCAGTGACTGACTACAGGACAGCCGTCAGTGGGATCCGGCCTGAGAACCTGAAGCAGG GAGAAGAGTTTGAAGTTGT

GAAGAAGGAAGTGGCAGAAATGTTGAAGGGCAGAATCCTGGTGGGGCATGCGCTACACAATGATTTAAAG GTTTTGTTCCTTGACCATCCAAAAAAGAA

AATCAGGGACACTCAGAAATTCAAACCATTCAGGAGTCGAGTAAAG AGTGGACGACCGTCTCTGAAACGGCTTTCTGAGAAAATTCTGGGGATCAGGGT

CCAACAGGCCGAGCACTGCTCA ATCCAGGATGCCCAGGCAGCAATGAGGCTTTACGTCATGGTGAAACGGGAATGGGAGAGCAGTACTGCAAACCGGCG

TGCCCCAGCTGCCACTCCACAGCACCGCATCAAGAACTCTTAGCACCATCCTACTGCTGTCGCCACCACCCTGTCCGTCAGAGACTTCTCAATCCAGTGG

CAGTTGGGATGGGGTTATGAGGCCTGTCAGGTCTATGCACAGCAGGGACTCTGTCTTTGGTGAGCTTTCTCAGAGCCATGGCTGCAGGCATGTGAGCTGC

GGGAACTTCCTCCTGAACTACCCAGGGCCTAATCATCCAGCACCTGTGTGTTGAGGTAGACTGGTCAGATACAGGGCAGAAGTCAGGGGTGTAGGTTCGA

GGAAGGAGAACATCATTGGAATGGAGGAGAGTGCTGCAGAGTCTATGTCTGCTGACCACCTGTGCTACCACTTAACAATGAGCATAGCTGGTCTCAGCCA

GGGCACTCAGCACCTTCCCTTAAGGAGCAAGAAGCGCCTTCTCTGTCAGGTAAGGGGATAAGCTCTGCTGGATCCAAGGGATCCAGGCTAAGGGCGTTCA

GTCTGCTGCAAACCAGTCTGGCCAGCACAGCAACCGCCCATTGAGGACTTTCTTAAAGCTACTGGGCTGGAGGTCCTTTCCCACTCCTTTGTCCTTTGCT

TGGCCTAAGATGCCAATGCCCCGCCATGTTTTCTCCAGAGAGTCCTTGGGGTGAGCCTTGGGGCACAGGTACACTCAGAGGTCTGAGAGCCTACCATGTG

GAACAGTGTAAGCAGAAAGGCCATCTTCCCACTGTCCTGCCAGCAGCTGTTCTGGGTAGCAGCAATTGCAGAGTGACCAGTGAACTTTATGGACTTAGCT

GACAACTCCTAGAACATGTGCACCCATGCATATGATGACAGATGTCTGCTTTTAATGCAGCTGTGGACTGAGGTGTGGCTCAGAGGACACTTGTTCACTA

AGTGTAAGACCCTGGTATCCTTTCCTAGAACTGTCAAAAATAAATGGATGGATC
Translation
MCACAVAGVAVSSLVVPTAESGEMKTKATAPVPQPGPIRKLARKKAKKKFRKSKALAGSGVPGSHPAAVAGRPPKAPENFSQNWKALQE - UNI1596 

- - UNI7284 - - UNI25898 - LLKQKSQAAEKPLVSQMDDKMHPQIIQQNRKKASDKSKGDKQRTEKAKSTRGSVTSAPTDRKILVPPTDTSGT

EQKKGAKKRTYSDISSHQGALKPKWKATEAAVILNQPTPTE EEDIWFDDVDPDDIEDAIGPEAAMLVRKRLGQKKRTISLEKEQAFGG GLTKALALDC

EMVGVGPKGEESIAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQG GEEFEVVKKEVAEMLKGRILVGHALHNDLK VLFLDHPKKKIR

DTQKFKPFRSRVK SGRPSLKRLSEKILGIRVQQAEHCS IQDAQAAMRLYVMVKREWESSTANRRAPAATPQHRIKNS
Transcript ENSMUST00000114019
Sequence
GCTTGCGCGGTTGCTGGAGTCGCGGTCTCTTCCCTGGTGGTTCCGACTGCGGAGAGCGGGGAGATGAAGACGAAGGCCACCGCGCCGGTGCCCCAACCTG

GGCCTATCAGGAAGCTCGCTAGGAAGAAAGCCAAGAAGAAGTTCAGGAAGAGCAAAGCTCTGGCAGGAAGTGGGGTTCCGGGAAGCCACCCGGCGGCTGT

GGCAGGCCGACCGCCGAAGGCCCCCGAGAACTTTTCTCAAAATTGGAAGGCGTTGCAAGAG - UNI1596 - - UNI7284 - - UNI25898 - C

TACTGAAACAAAAGTCACAGGCCGCAGAAAAACCTCTTGTCTCTCAGATGGATGACAAAATGCACCCCCAAATAATCCAGCAGAACAGAAAAAAGGCCTC

AGATAAATCAAAGGGAGACAAGCAGAGGACAGAAAAGGCCAAGAGCACTAGGGGTTCTGTTACATCTGCACCTACGGACAGGAAGATACTAGTACCTCCC

ACAGATACCTCTGGAACAGAGCAGAAGAAAGGAGCCAAGAAGAGGACATATAGTGACATCTCTTCTCATCAAGGGGCTCTCAAGCCTAAGTGGAAAGCTA

CGGAGGCAGCTGTTATCTTGAATCAGCCCACGCCCACTGA GGAAGACATCTGGTTTGATGATGTGGATCCAGATGATATTGAGGATGCCATAGGCCCAG

AGGCAGCCATGCTGGTACGGAAGAGGCTGGGGCAGAAGAAGAGGACCATCTCCCTGGAGAAGGAACAAGCCTTTGGCGG CTTGACAAAAGCCTTGGCCC

TGGATTGTGAGATGGTAGGCGTGGGTCCCAAAGGGGAAGAGAGCATCGCAGCCCGTGTGTCGATCGTGAACCAGTATGGGAAGTGTGTTTATGACAAGTA

CGTCAAGCCAACTGAGCCAGTGACTGACTACAGGACAGCCGTCAGTGGGATCCGGCCTGAGAACCTGAAGCAGG GAGAAGAGTTTGAAGTTGTGAAGAA

GGAAGTGGCAGAAATGTTGAAGGGCAGAATCCTGGTGGGGCATGCGCTACACAATGATTTAAAG AGTGGACGACCGTCTCTGAAACGGCTTTCTGAGAA

AATTCTGGGGATCAGGGTCCAACAGGCCGAGCACTGCTCA ATCCAGGATGCCCAGGCAGCAATGAGGCTTTACGTCATGGTGAAACGGGAATGGGAGAG

CAGTACTGCAAACCGGCGTGCCCCAGCTGCCACTCCACAGCACCGCATCAAGAACTCTTAGCACCATCCTACTGCTGTCGCCACCACCCTGTCCGTCAGA

GACTTCTCAATCCAGTGGCAGTTGGGATGGGGTTATGAGGCCTGTCAGGTCTATGCACAGCAGGGACTCTGTCTTTGGTGAGCTTTCTCAGAGCCATGGC

TGCAGGCATGTGAGCTGCGGGAACTTCCTCCTGAACTACCCAGGGCCTAATCATCCAGCACCTGTGTGTTGAGGTAGACTGGTCAGATACAGGGCAGAAG

TCAGGGGTGTAGGTTCGAGGAAGGAGAACATCATTGGAATGGAGGAGAGTGCTGCAGAGTCTATGTCTGCTGACCACCTGTGCTACCACTTAACAATGAG

CATAGCTGGTCTCAGCCAGGGCACTCAGCACCTTCCCTTAAGGAGCAAGAAGCGCCTTCTCTGTCAGGTAAGGGGATAAGCTCTGCTGGATCCAAGGGAT

CCAGGCTAAGGGCGTTCAGTCTGCTGCAAACCAGTCTGGCCAGCACAGCAACCGCCCATTGAGGACTTTCTTAAAGCTACTGGGCTGGAGGTCCTTTCCC

ACTCCTTTGTCCTTTGCTTGGCCTAAGATGCCAATGCCCCGCCATGTTTTCTCCAGAGAGTCCTTGGGGTGAGCCTTGGGGCACAGGTACACTCAGAGGT

CTGAGAGCCTACCATGTGGAACAGTGTAAGCAGAAAGGCCATCTTCCCACTGTCCTGCCAGCAGCTGTTCTGGGTAGCAGCAATTGCAGAGTGACCAGTG

AACTTTATGGACTTAGCTGACAACTCCTAGAACATGTGCACCCATGCATATGATGACAGATGTCTGCTTTTAATGCAGCTGTGGACTGAGGTGTGGCTCA

GAGGACACTTGTTCACTAAGTGTAAGACCCTGGTATCCTTTCCTAGAACTGTCAAAAATAAATGGATGGATC
Translation
MKTKATAPVPQPGPIRKLARKKAKKKFRKSKALAGSGVPGSHPAAVAGRPPKAPENFSQNWKALQE - UNI1596 - - UNI7284 - - UNI2589

8 - LLKQKSQAAEKPLVSQMDDKMHPQIIQQNRKKASDKSKGDKQRTEKAKSTRGSVTSAPTDRKILVPPTDTSGTEQKKGAKKRTYSDISSHQGALKP

KWKATEAAVILNQPTPTE EEDIWFDDVDPDDIEDAIGPEAAMLVRKRLGQKKRTISLEKEQAFGG GLTKALALDCEMVGVGPKGEESIAARVSIVNQY

GKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQG GEEFEVVKKEVAEMLKGRILVGHALHNDLK SGRPSLKRLSEKILGIRVQQAEHCS IQDAQAAMR

LYVMVKREWESSTANRRAPAATPQHRIKNS

For any suggestions or comments, please send an email to unitrap@crg.es