Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052414 (AC137156.3-201)
Chromosomal location
Chr 15: 102364056 - 102455852 (-)
Description
Cyclic AMP-dependent transcription factor ATF-7 (Activating transcription factor 7)(Transcription factor ATF-A) [Source:UniProtKB/Swiss-Prot;Acc:Q8R0S1]
RefSeq_dna
NM_146065 
RefSeq_peptide
NP_666177.1 
UniGene
Mm.208714 
Uniprot/SWISSPROT
Q8R0S1 
Uniprot/SPTREMBL
Q3U2X8 Q3US59 Q3TZR9 
Human Ortholog
ENSG00000170653 (ATF7)
Omim not available
UniTrap UNI8391
Vector Insertion
Chr 15: 102455520 - 102455792
Public Clones RRO208 (baygenomics) IST10858A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17088
Vector Insertion
Chr 15: 102424172 - 102455469
Public Clones (sanger) 5SE085D03 (ggtc) 5SD175E11 (ggtc) IST14961B10 (tigm)
Private Clones OST449402 (lexicon) OST273759 (lexicon) OST251352 (lexicon) OST189090 (lexicon)
OST155504 (lexicon) OST81368 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1850
Vector Insertion
Chr 15: 102393842 - 102424102
Public Clones AE0314 (sanger) AQ0063 (sanger) AC0267 (sanger) AZ0578 (sanger)
AN0240 (sanger)
Private Clones OST431163 (lexicon) OST348097 (lexicon) OST222364 (lexicon) OST207768 (lexicon)
OST188591 (lexicon) OST166105 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9232
Vector Insertion
Chr 15: 102388010 - 102393744
Public Clones (sanger) RRC235 (baygenomics)
Private Clones OST275282 (lexicon) OST53189 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8849
Vector Insertion
Chr 15: 102377699 - 102378203
Public Clones XM081 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10115
Vector Insertion
Chr 15: 102368613 - 102368723
Public Clones RRA037 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108828
Sequence
GCAGGAGACAGATTGTGGGACCGAGCGCGGGCGGGCGGGAGGCGCCGGAGCTACCAGCGG - UNI8391 - - UNI17088 - CTCTGCTCTGCTTT

ATGAAATATGGGAGACGACAGACCGTTTGTGTGCAGTGCCCCGGGCTGTGGACAG - UNI1850 - AGATTTACAAATGAGGACCACCTGGCAGTTCA

TAAACATAAGCATGAGATGACACTGAAATTTGGCCCAGCCCGAACGGACTCAGTCATCATTGCAG - UNI9232 - ATCAAACGCCTACTCCAACTAG

ATTCCTGAAGAACTGTGAGGAAGTGGGGCTCTTCAATGAACTAGCTAGCTCCTTTGAACATGAATTTAAGAAAGCTTCTGATGACGATGAGAAAAAG GG

TGCTGCTGGGCCTCTTGACATGTCTCTGCCTTCTACACCAGACATCAAAATCAAGGAAGAAGAGCCAGTGGAAGTAGACTCATCGCCCCCTGACAGTCCT

GCTTCTAGCCCCTGTTCCCCACCACTGAAGGAGAAG GAAGTTACCACAAAACCGGTTGTGATCTCTACCCCTACACCTACCATTGTACGTCCTGGCTCC

CTGCCTCTCCACTTAGGTTATGATCCACTTCATCCAACTCTTCCTTCCCCAACCTCTGTCATCACACAGGCTCCACCATCCAACAGGCAAATAGG ATCT

CCTACTGGCTCCCTCCCTCTCGTCATGCATCTTGCTAATGGACAGACCATGCCTATGTTGCCAGGGCCTCCAGTACAGATGCCTTCTGTTATTTCG - U

NI8849 - CTGGCCAGACCTGTGTCCATGGTGCCCAACATTCCTGGTATACCTGGCCCACCGGTTAACAACAGTGGCTCCATTTCTCCCTCTGGCCACC

CTATGCCGTCAGAAGCCAAAATG AGACTAAAAGCCACGCTGACCCATCAAGTTTCTTCAATCAATGGAGGTTGTGGAATGGTGGTGGGTACTGCAAGCA

CCATGGTGACTGCCCGTCCAGAGCAAAACCAGATCCTCATCCAGCACCCAGATGCCCCATCCCCTGCCCAGCCACAG GTCTCTCCAGCTCAGCCCACCC

CTAGCACTGGGGGACGGCGACGGCGTACAGTGGATGAAGATCCAGATGAGCGGCGGCAGCGGTTTTTAGAGCGAAACAGAGCTGCAGCCTCTCGATGCCG

GCAAAAGCGGAAACTGTGGGTGTCCTCCCTGGAAAAGAAGGCAGAAGAACTTACTTCTCAGAACATTCAGCTGAGT - UNI10115 - AATGAAGTCA

CATTACTACGCAATGAGGTGGCTCAGCTGAAGCAGCTACTGTTAGCTCATAAAGATTGCCCAGTCACTGCACTACAGAAAAAGACTCAAGGCTACCTAGG

TAAGTGATTTGTAACCTAAGCGAAATCAGTTGGTAAATCACAGGTATTGAGTATCTTAGGTATTCATAAAGCCATTCTTTCTGGTGCATCAGTCATTCAC

ACACACACACACAAAATATTTTTTCAATCTGTAATAGCAAGAAGATCGGTAGTTCAATCTGTGTTATCTATAACCACTGCAGAGAAGTGCATGAAGTAGT

TCTTGCATCTGTTTTATTTACATTCTTTACCATTTTCACAGTTCTCTCATGAAGTAGCCATCCTATTTGGAAATGAGAAAGCTACTCAGATTAGATCACT

TGCCCAAGTCAAACAGTAGGAAAGTGGTAGAGGTCTTTTGATCCCAAAGACAGTCTTGGCCTAGAGAAAGATGAACAGCTGATGGTTCTTAGAAACTGAA

AAGTTGGGACTTGAGGACAGAGTTCACTTTCTAATGATAGCCCAGTCTCGGTTTCAGTTTGTAATCAGAGATTTCTACAGACTTGTGTTCAGCATTAACA

GTGTTACAAAATACATACTATAGTGAAAAATTTGTTATGGATAATTAAAACTAATAATTGCTAGTTTTCCTTTACAGATTAAATAAATGCATAGAAATAC

TAGATATAGCAAATAGTTTTTTCACTAGTTGCATTCATCATTTCAGAGATGTAAAATATTTTTCAGAGATTCTGCGAAAAAATTTAAGAATCGTTATTAA

ATTATTTATTTAAGTGTTAATCTATACTTCCAGGTGTGTTATTTGTTAAGCAAGTACTGACAGAGTTGTTGTTCTGTGCTAGACACATAACAGGAAACAA

ACAGATTAGGTTAGATTCCTGTCCTTGAAGAGCTTGTATTTTAGTACATAAGACAAATTAAAAAAAAAAGATGAAATATGTGGCTTGTGGTAAATGTGAA

AACAACAAAAAAAATAATACAGCTAGAGTATAGAGATTGCTCAGGGGGTAAGAGCATTTACTGCTCCTGTGGAAGGCCTGTGTTCACTTTCCAGCACTCA

TAACTATCGATAACTCCAGTTCCAGGTGATCTGAGATCCTCTTTTGCTGTCTCGTGTACCTGGCTCATGGATGTATGTGCATGTAGCTCTGGCTACCCTG

GAACACTCTCTCTCTCTTTTAAAAGATTTATTTATTTAATGTATATGAGTACACCATTGCTTTCTTCAGACAAACCAGGAGAGGGCATCAGACCCCATTG

CAGATGGTTGTAAGCCACCATATAGTTGTTGGGAATTGAACTCAGGACCTCTAGAAGAGCAGTATCAGTGTTCTTAACCACTGAGCCATCTCTCCAGCCC

TGCCCTGGCACTCTCTATGTAGATCAGGCTGGCCTTGACTCATAGAGATAGTTTTTAATCCCAAAGTGCTGGGATTAAAAGCAAACAATCAAACCCAGCA

TAAATCTTAAAATAATAATAACAGTAATAACATAACTAGAAATGGTGCTACAAGAATGCAGTCCCAGCACCCAGAAGGCTGAGACAGGAAGTTCATGAAT

TCAAGCCCATCCTGAGAGACTTTGTCTC
Translation
 - UNI8391 - - UNI17088 - MGDDRPFVCSAPGCGQ - UNI1850 - RFTNEDHLAVHKHKHEMTLKFGPARTDSVIIAD - UNI9232 -

 DQTPTPTRFLKNCEEVGLFNELASSFEHEFKKASDDDEKK GAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEK EVTTKPVVIST

PTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQIG GSPTGSLPLVMHLANGQTMPMLPGPPVQMPSVIS - UNI8849 - LARPVSMVPN

IPGIPGPPVNNSGSISPSGHPMPSEAKM RLKATLTHQVSSINGGCGMVVGTASTMVTARPEQNQILIQHPDAPSPAQPQ VSPAQPTPSTGGRRRRTVD

EDPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLS - UNI10115 - NEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQGYLGK
Transcript ENSMUST00000064254
Sequence
CTTTTGGAGGAAGGCGGGGCCAGAGGACTGAAGTGTGGGGAGAACTTGGG - UNI17088 - CTCTGCTCTGCTTTATGAAATATGGGAGACGACAGA

CCGTTTGTGTGCAGTGCCCCGGGCTGTGGACAG - UNI1850 - AGATTTACAAATGAGGACCACCTGGCAGTTCATAAACATAAGCATGAGATGACA

CTGAAATTTGGCCCAGCCCGAACGGACTCAGTCATCATTGCAG - UNI9232 - ATCAAACGCCTACTCCAACTAGATTCCTGAAGAACTGTGAGGAA

GTGGGGCTCTTCAATGAACTAGCTAGCTCCTTTGAACATGAATTTAAGAAAGCTTCTGATGACGATGAGAAAAAG GGTGCTGCTGGGCCTCTTGACATG

TCTCTGCCTTCTACACCAGACATCAAAATCAAGGAAGAAGAGCCAGTGGAAGTAGACTCATCGCCCCCTGACAGTCCTGCTTCTAGCCCCTGTTCCCCAC

CACTGAAGGAGAAG GAAGTTACCACAAAACCGGTTGTGATCTCTACCCCTACACCTACCATTGTACGTCCTGGCTCCCTGCCTCTCCACTTAGGTTATG

ATCCACTTCATCCAACTCTTCCTTCCCCAACCTCTGTCATCACACAGGCTCCACCATCCAACAGGCAAATAGG ATCTCCTACTGGCTCCCTCCCTCTCG

TCATGCATCTTGCTAATGGACAGACCATGCCTATGTTGCCAGGGCCTCCAGTACAGATGCCTTCTGTTATTTCG - UNI8849 - CTGGCCAGACCTG

TGTCCATGGTGCCCAACATTCCTGGTATACCTGGCCCACCGGTTAACAACAGTGGCTCCATTTCTCCCTCTGGCCACCCTATGCCGTCAGAAGCCAAAAT

G AGACTAAAAGCCACGCTGACCCATCAAGTTTCTTCAATCAATGGAGGTTGTGGAATGGTGGTGGGTACTGCAAGCACCATGGTGACTGCCCGTCCAGA

GCAAAACCAGATCCTCATCCAGCACCCAGATGCCCCATCCCCTGCCCAGCCACAG GTCTCTCCAGCTCAGCCCACCCCTAGCACTGGGGGACGGCGACG

GCGTACAGTGGATGAAGATCCAGATGAGCGGCGGCAGCGGTTTTTAGAGCGAAACAGAGCTGCAGCCTCTCGATGCCGGCAAAAGCGGAAACTGTGGGTG

TCCTCCCTGGAAAAGAAGGCAGAAGAACTTACTTCTCAGAACATTCAGCTGAGT - UNI10115 - AATGAAGTCACATTACTACGCAATGAGGTGGC

TCAGCTGAAGCAGCTACTGTTAGCTCATAAAGATTGCCCAGTCACTGCACTACAGAAAAAGACTCAAGGCTACCTAG - UNI10115 - AAAGTCCCA

AGGAAAGCTCAGAGCCAACGGGTTCTCCAGCCCCAGTGATTCAGCACAGTTCCGCATCAGCCCCTAGCAATGGCCTTAGTGTTCGATCTGCAGCTGAAGC

TGTGGCCACCTCGGTCCTCACTCAGATGGCCAGCCAAAGGACAGAACTGAGCATGCCCATACAGTCACATGTGATCATGACCCCACAGTCGCAGTCTGCG

GGCAGATGATGCCTCCCATGATGGAGAGGTCCCCAGCCAGAGCTCGCCCGCCTGAGCCAAGAGAGAGATCAACTTAACCCCTCCTGTCTGTCTTGGAATT

GGGCAGAATGGAGAGGGAGAAATTGTGTGTTGTGAGTATGGACAGATGTGGGGCTTTTCTCTTTAGCCACATGATCATGTACGATTAACACCTGTACTAG

GCGCTTCTGGCCCCAAAGCCACATAGATCATCCCCCAAGGGTAGGGTTTCTTATGTACCTACAGCCAAAGGCCTTTCCATATGGTCTGAGCAGTCATCCC

TGGCCCTGATGCATGTGTGCCTGTCTCTTAACACTAACCCTTGCACTTGTAGGTTTGGGGTTTCTCAGTGTCCCCTCCTCCCATTGACCTGTGGCTGTTA

CCTTCTTATTTCTTATTAGCATGCCACTTCCTGCCAGATGGAGGGAGGTGAGATTTGATGGCGTGTTACTTGCTGTCCCACCCCTAGCCACCACATGCAC

TCAGGACTTTGTCTCCCAATAGCTGCTTATTTGTCTCTTTCCTCCTTCCTAAACTGCAGTGAAAACATTCACTTGTTGAGAATGTAATACATTTAATGTA

TGAGG
Translation
 - UNI17088 - MGDDRPFVCSAPGCGQ - UNI1850 - RFTNEDHLAVHKHKHEMTLKFGPARTDSVIIAD - UNI9232 - DQTPTPTRFLK

NCEEVGLFNELASSFEHEFKKASDDDEKK GAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEK EVTTKPVVISTPTPTIVRPGSLP

LHLGYDPLHPTLPSPTSVITQAPPSNRQIG GSPTGSLPLVMHLANGQTMPMLPGPPVQMPSVIS - UNI8849 - LARPVSMVPNIPGIPGPPVNNS

GSISPSGHPMPSEAKM RLKATLTHQVSSINGGCGMVVGTASTMVTARPEQNQILIQHPDAPSPAQPQ VSPAQPTPSTGGRRRRTVDEDPDERRQRFLE

RNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLS - UNI10115 - NEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQGYLE - UNI10115 - 

ESPKESSEPTGSPAPVIQHSSASAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVIMTPQSQSAGR

For any suggestions or comments, please send an email to unitrap@crg.es