Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052439 (OTTMUSG00000022410)
Chromosomal location
Chr 8: 74432507 - 74440253 (+)
Description
predicted gene, OTTMUSG00000022410 Gene [Source:MGI Symbol;Acc:MGI:3642748]
UniGene
Mm.251482 
MGI
MGI:3642748 
Uniprot/SPTREMBL
Q8BYD7 
Human Ortholog
not available
Omim not available
UniTrap UNI25327
Vector Insertion
Chr 8: 74432638 - 74437020
Public Clones not available
Private Clones OST187687 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053105
Sequence
AGTCCGCTGAGGGAGTTTGGGGTCGCTGGACCTCAGGCCGCTCCACCCTGGAGCCGCGTGAGGCTGCTTGAGGTCCGGAGCTCAGCTATG - UNI2532

7 - GAGTCTGTATCTTTTGAGGATGTGGCTGTGAACTTCACTGCGGAGGAGTGGGCTTTGCTGAATTCTTCCCAAAAGAGGCTACACAGAGATGTGATG

CAGGAAACCTTCAGGAATTTGGCTGCCATAG CAAAAAAGCAAGAAGACTGGATCCTTGAAGATGGCTCTAAAAATTTAAGAAAAATTCCTCCCATTTCA

GTTCAGACTGACTATAAACTATGTGAGAGTCAAGAATGCACAGAGAAACCAGGCACATGTAAGAAGTGCGGGAAATTCTTTAGTTCTCCCCAAAGTTTTC

TGGAACATATGAAGACTCACAATGAAGAGAAAACTTACAAATATAAGCAAACTGAAGACAGTTTTAGCAGACACAGTTTTGTTCAGGGGCATGAAAGAAT

GCATGCTACGGAACAGCCCTGTGTTTTAAAACAAAGTGGGAAAGACTCTTTGACTCTTGCTGGTATTCAACAGCACATAATAACACATAATGGAGATGAG

CCATATATATGTAAAGTATGTGGTAAAGCCTTTTACTCTTCCAGTTCTTTCTTGACACATAAAAGAACTCACACCAGAGAACAGCTTTATATATGTAAGC

AATGTGGCAAAACCTTCACTTATTCCAGTGGCCTTCGTCGCCATGAAAGGACCCATAGTGGAGAGAAACCCTATGAATGCAAGCAGTTTCTGAAAGTCTT

TCCTTCTTTGAGGAAGGTTGAAAGTCATGAACAAACTCACAATGGAATAAAATACATATGTAATCAGTGT
Translation
M - UNI25327 - ESVSFEDVAVNFTAEEWALLNSSQKRLHRDVMQETFRNLAAIA AKKQEDWILEDGSKNLRKIPPISVQTDYKLCESQECTEKPG

TCKKCGKFFSSPQSFLEHMKTHNEEKTYKYKQTEDSFSRHSFVQGHERMHATEQPCVLKQSGKDSLTLAGIQQHIITHNGDEPYICKVCGKAFYSSSSFL

THKRTHTREQLYICKQCGKTFTYSSGLRRHERTHSGEKPYECKQFLKVFPSLRKVESHEQTHNGIKYICNQC
Transcript ENSMUST00000110002
Sequence
CTTTCTTCCTGGCAACGCCATTGTCACTGCTCTCTCAGTCCAGTCCGCTGAGGGAGTTTGGGGTCGCTGGACCTCAGGCCGCTCCACCCTGGAGCCGCGT

GAGGCTGCTTGAGGTCCGGAGCTCAGCTATG - UNI25327 - GAGTCTGTATCTTTTGAGGATGTGGCTGTGAACTTCACTGCGGAGGAGTGGGCTT

TGCTGAATTCTTCCCAAAAGAGGCTACACAGAGATGTGATGCAGGAAACCTTCAGGAATTTGGCTGCCATAG CAAAAAAGCAAGAAGACTGGATCCTTG

AAGATGGCTCTAAAAATTTAAGAAAAATTCCTCCCATTTCAGTTCAGACTGACTATAAACTATGTGAGAGTCAAGAATGCACAGAGAAACCAGGCACATG

TAAGAAGTGCGGGAAATTCTTTAGTTCTCCCCAAAGTTTTCTGGAACATATGAAGACTCACAATGAAGAGAAAACTTACAAATATAAGCAAACTGAAGAC

AGTTTTAGCAGACACAGTTTTGTTCAGGGGCATGAAAGAATGCATGCTACGGAACAGCCCTGTGTTTTAAAACAAAGTGGGAAAGACTCTTTGACTCTTG

CTGGTATTCAACAGCACATAATAACACATAATGGAGATGAGCCATATATATGTAAAGTATGTGGTAAAGCCTTTTACTCTTCCAGTTCTTTCTTGACACA

TAAAAGAACTCACACCAGAGAACAGCTTTATATATGTAAGCAATGTGGCAAAACCTTCACTTATTCCAGTGGCCTTCGTCGCCATGAAAGGACCCATAGT

GGAGAGAAACCCTATGAATGCAAGCAGTTTCTGAAAGTCTTTCCTTCTTTGAGGAAGGTTGAAAGTCATGAACAAACTCACAATGGAATAAAATACATAT

GTAATCAGTGTGGGATAGCCTTCAGTGATCACTGTTCCCTTCAGTGCCATGAAAAGATTCATAGTTTAGAGAAACCCTATGTATACAAGCAATGTGGGAA

GACATTCACTTGTTCTAGTGCCTTGCGAAGACATGAACGAATTCATACTGGAGTGAAACCCTATGAATGCAAGGTATGTGGGAAAGCCTTCATTGATTGC

AGTTCTCTTCAGTGTCATGAAAGGATTCATAGTGGAGAGAAACCTTATGTATGTAAGCTGTGTGGGAAAGCGTTCAGTCGTCAGGGCTCTCTGAAGTGTC

ATGAAAGAATTCACAGTGGAGAGAAACCCTATGCATGTAAGCAGTGTGGGAAAGCCTTCATGCATCACAATGCTCTTCGATACCATGAACAGATTCACAG

GGGAGAGAAGGCCTATGGCTGTAAGCAGTGTGGGAAAGCCTTTGTGTTGAGCAGCGCACTGAAAAAACACGAGCGGATACATAGTGGATTGAAACCTTGT

CTATGCAGGGTGTGTGGGAAAGCCTTCACGTTTCACAGTTCCCTTCATTGCCATGAAAGGACTCATACTGGGGAGAAACCCTATGTGTGTAAGCAGTGTG

GGAAAGCCTTTATGTATCACAGTTCTCTCCGTTGCCATGAAAATATACACAGTGCAGAGAAACCCTATGTGTGTAAGCTGTGTGGGACCGCCTTCACTTA

TCACAGTTCTCTTCAACGCCATGAAAGAATCCACAGAGGAGAGAAACCATATGTATGTAAATTCTGTGCAAAAGCCTTCACTGATCACAGTTCCCTACGA

TGCCATGAAAGAATTCACACTGGAGAGAAACCGTATGTATGTAAACAATGTGGGAAATCCTACAGTACTCATGGTTCCCTTAGATACCATGAAAAAGTGC

ACTGTGTGTAAGCCACGTTGGAAGACCTTCTCCTCTTTGAATAAGTTTTAATTTCATTAACTCAAAAGAAAAACAAACAAACAAACTATACGGATATAAG

CTATGTGAATAAGCCTTAGCATGTTCTGGTTCCCTTAAAAAAAATGAATGGGGACACAGTGGAAACTTATCTCTAAATATAAACTAAAGGAACGCTCCAG

ATCTCTCTAGCAAACATGATGGTATAATGAATTTAACTTGTATCGATGCAAAGCATGTGAGATTATCTCTACTTGTCTCAGTTCACTTCTCAGAAACCAC

TATGGAGATGAGGAGATGTCTCAGTTTGTATAGTCCTTGCCATAGAAGCATGAGATCCTGGGTTTAAATCCTCAGCACCCATATAAAAGCCAGACATGAT

GGCATACCCCTGTGTCCAGTGCTAGGGAGGCAGAGACAAGAGACCCTGAGGCTTGCTGGTTAGCTGGTCCATGATGGCAATGCACATGTATGGAGTTTCC

TGTAGAAGCCTAAACTTGGAATGGACTTAGACCAACTTTATTTCCAGTTTCTTCTAAAACTGCCCACTGATTAGTCACATGGCTCTTAGCTTTAGGATTA

ACTCCTGCATCAACATTCTTCAAATCACTGGACAACTTTGGGCATCAAGTCAGTTCAGGTCCAATAAGAGAGTTCTCAAAAACTAAAGTGGAGAATGATT

AAGGAAGACACCCAACACACAAAAGTCTGGATTTTCCTACTAGGCTCTTGTCATTACATCAATCTCTGGCCTCTATGTGCAAGTACAGTGTGTACCCACA

CATATGAACACTCATCCACACAATCATGCACACCACACACATGAAAGAACACACCATATCAAGAACCTCCATTAGAAGAAACCTGCAAGTCTTCAGTTGT

CCAGTATATCAAAATACACAGTCAAAACCTTATACATTTGGTAGAATTGCCTTTTGTAGCATATAATGTCAAAGTCTGATGCAATACGATTCTGTTAACA

CAACTAATGTGAAGAGCCTGGTATAAAATAATTCGTGTAGAATGCTTTAGAGATTGCACAGTTTAGAGGAGGGTTTGTCAGTGGCACATTTGTAGGTAGA

TCTGAATAATACAGTGTGCTCATTTTATTCTTGAAAATAAATGTTCTCTGGGTGTGGTGGTGCACACCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGG

AGGATTTCTGAGTTCGAGGCCACCCTGGTCTACAGAGTGAGTTAGTTCCAGGACAGCCAGGGCTATACAGAGAAACCCCGTCTTGAAAAACCAAAATAAT

AATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAATAAAATAAAAAGAAAATAAA
Translation
M - UNI25327 - ESVSFEDVAVNFTAEEWALLNSSQKRLHRDVMQETFRNLAAIA AKKQEDWILEDGSKNLRKIPPISVQTDYKLCESQECTEKPG

TCKKCGKFFSSPQSFLEHMKTHNEEKTYKYKQTEDSFSRHSFVQGHERMHATEQPCVLKQSGKDSLTLAGIQQHIITHNGDEPYICKVCGKAFYSSSSFL

THKRTHTREQLYICKQCGKTFTYSSGLRRHERTHSGEKPYECKQFLKVFPSLRKVESHEQTHNGIKYICNQCGIAFSDHCSLQCHEKIHSLEKPYVYKQC

GKTFTCSSALRRHERIHTGVKPYECKVCGKAFIDCSSLQCHERIHSGEKPYVCKLCGKAFSRQGSLKCHERIHSGEKPYACKQCGKAFMHHNALRYHEQI

HRGEKAYGCKQCGKAFVLSSALKKHERIHSGLKPCLCRVCGKAFTFHSSLHCHERTHTGEKPYVCKQCGKAFMYHSSLRCHENIHSAEKPYVCKLCGTAF

TYHSSLQRHERIHRGEKPYVCKFCAKAFTDHSSLRCHERIHTGEKPYVCKQCGKSYSTHGSLRYHEKVHCV

For any suggestions or comments, please send an email to unitrap@crg.es