Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052459 (Atp6v1a)
Chromosomal location
Chr 16: 44085517 - 44139309 (-)
Description
ATPase, H+ transporting, lysosomal V1 subunit A Gene [Source:MGI (curated);Acc:Atp6v1a-001]
RefSeq_dna
NM_007508 
RefSeq_peptide
NP_031534.2 
UniGene
Mm.397717 Mm.472398 Mm.217787 
MGI
MGI:1201780 
Uniprot/SWISSPROT
P50516 
Human Ortholog
ENSG00000114573 (ATP6V1A)
Omim not available
UniTrap UNI22635
Vector Insertion
Chr 16: 44116899 - 44116996
Public Clones not available
Private Clones OST289498 (lexicon) OST280401 (lexicon) OST127966 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29730
Vector Insertion
Chr 16: 44116899 - 44139133
Public Clones (sanger) E090C09 (ggtc) IST14192D2 (tigm) IST14258D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17927
Vector Insertion
Chr 16: 44114856 - 44116899
Public Clones not available
Private Clones OST433452 (lexicon) OST61873 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3861
Vector Insertion
Chr 16: 44091379 - 44098839
Public Clones AW0666 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063661
Sequence
AGAAAAAGAAACTAACGCTTTTCTGAAGTCGCGGAACCATTCACATCCAAGGCGGTCCGCAAAGATTTAAGCCTGCGAGACGCGGCGTGACGGGCGAGGG

GAAGCGGGGTGGGGCTTGAGGACACATGACTAGCTAGGACTGGCCCGCCTCCTGCAGCTGAAGACTTCCCCTCTCTCAGTGACAGAGCCTCTGGGTCCCG

TCTAGGTACACTTTCTGCATTTCGAGCCCGGGCAGGTGAGGTGCGACAG - UNI22635 - - UNI29730 - GTAAATTTAACACAATGGATTTCT

CCAAGCTACCCAAAATCCGAGATGAGGATAAAGAAAGTACATTTGGTTATGTGCATGGAGTCTCAGGGCCTG - UNI17927 - - UNI22635 - -

 UNI29730 - TGGTTACAGCCTGTGACATGGCGGGCGCTGCCATGTACGAGCTGGTGAGAGTGGGGCACAGCGAGCTGGTTGGAGAAATTATTCGATT

GGAAGGTGACATGGCCACCATTCAGGTGTATGAAGAAACTT CTGGTGTCTCTGTTGGAGACCCCGTACTCCGCACTGGTAAACCTCTCTCGGTCGAGCT

GGGTCCCGGGATTATGGGAGCCATTTTTGATGGTATACAGAGACCTCTGTCGGATATCAGCAGTCAGACCCAAAGTATCTACATCCCCAGAGGAGTCAAT

GTGTCTGCTCTCAGCAGAGATATCAAATGGGAGTTTATACCCAGCAAAAACCTACGG GTTGGTAGTCATATCACTGGTGGAGACATTTATGGGATTGTC

AATGAGAACTCCCTCATCAAACACAAAATCATGTTGCCCCCACGTAACAGAGGAAGCGTGACTTACATCGCGCCGCCTGGGAATTATGATGCATCC GAT

GTCGTCCTGGAGCTTGAGTTTGAAGGTGTGAAGGAGAAGTTCAGCATGGTCCAAGTGTGGCCTGTGCGGCAGGTGCGGCCTGTCACTGAGAAGCTGCCCG

CCAATCACCCCTTGCTTACTGGCCAGAGAGTCCTCGATGCCCTTTTCCC GTGTGTTCAGGGAGGAACTACTGCTATCCCAGGCGCCTTTGGCTGTGGAA

AGACTGTGATTTCCCAGTCTCTATCCAAGTACTCCAACAGTGACGTCATCATCTATGTCGGCTGCGGTGAGAGAGGCAACGAGATGTCAGAAGTTCTCCG

CGACTTCCCTGAG CTCACCATGGAGGTTGATGGGAAAGTAGAGTCCATCATGAAGAGGACAGCGCTGGTAGCCAACACCTCCAACATGCCTGTGGCTGC

GAGAGAGGCCTCCATCTACACTG GAATTACACTATCAGAATATTTCCGTGACATGGGCTACCACGTCAGTATGATGGCCGACTCTACCTCTAGATGGGC

TGAGGCCCTCAGAGAAATCTCTGGTCGCTTAGCTGAGATGCCTGCAG ATAGTGGATACCCTGCATACCTTGGTGCCCGGCTGGCTTCTTTCTATGAGCG

AGCAGGCAGAGTGAAATGTCTCGGAAACCCTGAGAGAGAAGGGAGTGTCAGCATTGTAGGAGC AGTTTCTCCACCTGGTGGTGATTTTTCTGATCCAGT

CACTTCTGCAACGCTGGGTATTGTTCAG GTGTTCTGGGGCTTGGATAAGAAGTTAGCTCAGCGCAAGCACTTCCCCTCTGTCAACTGGCTCATCAGCTA

CAGCAAGTACATGCGTGCCCTGGACGAGTACTATGACAAGCACTTCACGGAGTTTGTTCCTCTGAGGACCAAAGCTAAGGAGATCCTGCAGGAAGAAGAG

GATCTGGCAGAAATCGTGCAGCTCGTGGGAAAG - UNI3861 - GCCTCTTTAGCAGAGACGGATAAAATCACTCTGGAGGTAGCAAAACTTATTAAA

GATGACTTCCTACAGCAAAATGGGTACACTCCTTATGACAG GTTCTGTCCATTCTACAAGACAGTGGGGATGCTGTCCAACATGATTTCATTCTATGAC

ATGGCCCGCCGAGCTGTGGAGACCACTGCCCAGAGTGACAATAAGATCACATGGTCCATTATCCGGGAGCACATGGGGGAGATTCTCTATAAACTCTCCT

CCATGAAATTCAAG GATCCAGTGAAAGATGGCGAGGCAAAGATCAAGGCCGACTATGCACAGCTTCTTGAAGATATGCAGAATGCATTCCGTAGCCTTG

AAGACTAGAACTGTGATTTCTTCCCTCTTCCACGGCAAGCTCATACGTGTATATTTTCCTGAATTTCTCATCTCCAACCCTTAGCTTCCATATTGTGCAG

CTTTGAGACTAGTGCCTATGTGTGTTCTTGTTCATTTTGCTGTTTCTTTGGTAGGTCTTATAAAACAAACATTCCTTTGTTCCAGTGTTTGAAGGAGCTA

GCTCCCTTACCTTTATCTGAAGTGGTGAATGTAGTGCATATGATATACATTGTAAGATACACATTGTAACATGATCCATACTGTAAACTTGTATGTAAGG

TGACTACCCCTTCCCTCATCTCCAGTAAACTGTAAACAGGACTACTGCATGTACTCTGTTGGGAATGGAAGGCCAGAACTCCATACCGTGGATGGATGGG

TACTTAGGAAACAACTCAGCATTTGTAGTCAGACCACTTGTAACTTAGTGGTTTGTTGAGTAACCATTTTGCAGGAAATACTTCCATTTAAAAACATAAA

AGATTAATGTTCCAATTATTTGTATCAATCAGGACCATTTTTGTGGGGCACTTGGGAACTATTTGTTTTTCAAACAGACATTTGCAAGACTGAACATAAT

AGATAAATCAGTTACCTCTGAAAATGTGAAAGAAAGGAAAAAAAAAAGAACCAGGTGGTCAAACTTAAATTGACATCATCTTGTTAAAGCATATTTTATT

TCACTAAGAGAAATTTAATATCAGAGACTTTTATATACTCAATTACTAGAAAACCTTTTTTTTAAGTACAATTTAAAAATCATTGAAAATGTGATCCACA

TCATAGCCATTCTTTTCCTCAGACTTAGTCAGACAAGCTTCTCAGAGTGGTGGGATGGGGATTAGAATACCACAGACACTCTGCAGTGCCTGCAGGCAGT

CGGCCCCAGGACAACCACTGCTGTAGGAGTTTGGGGCCAGGGTGGCATGGTTTTCACAAGGTACACGTGTCACGTGTTTGTTTGCCTGTTGACATTCTGA

AAACAGCAAGTTTACCAATTGCAGAAAATACTTTCTGTTTTCTCTTTCACATGCTCAGAAAGCTTCTCAAAGGTATCTGGTCACAGCAGCTTCCTTCCTG

TTATAGAGGTAAAAGGTGTTCTTATATTTAACTGGTAACAAAAGAAAAAAGAAAAAAGAAAAGATCAATTTTTGTCTTGATGTTTCAGTGTGTTTAAATA

ATAATTCCCATACTTGCTTAATAAGGCTCGCTTCAGAGAGCTTGGCGAGCGAGCTCCCTGTTCACTCTCTCCAGCTGATAGTGCTGTCAGTATACACTTC

AGATGTAATGTGTAAATCCTTGCTGGTGCATGTCTACACAGTGGACTGCTGCTGAAGAAGGATATTCTTCCAATTATTGAACACTGTTGACAGATATGGA

TTATGCAATGGCTTGTTGGGAGGTGGATTAGTGGTGCTGCTTAATCGGTTTGCTTCCAATGTGGCTTCGTATCCAGGAGCCCTGACTAGCGGAGATGAGA

AAGATTTCAAAACCTGTCTGCTTATACCTACCAGCAACCTAGGCTTGTGATCAGAATGAATGATCCCAAGAAACTACTTGACCAAGTTTGTTTTTGTTGT

CCTGGATTCGAGATGTGTTTTCTTCCTTGCTCTAAGACTGTTGATGTATGAGTGTGAAGAGGCTACAGAAACAATGCCCAGATTTTCACTGTAACTTTCC

CTTTGCCCACACTGTAGAACTTGAGATTGTTCACTGATAGTGCGTCTTTAGTAAGGATGTGTTAAAATATAGCAGTCTTTTTAAAAG
Translation
 - UNI22635 - - UNI29730 - MDFSKLPKIRDEDKESTFGYVHGVSGPV - UNI17927 - - UNI22635 - - UNI29730 - VVTAC

DMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETS SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRD

IKWEFIPSKNLR VGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDAS DVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLL

TGQRVLDALFP PCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPE LTMEVDGKVESIMKRTALVANTSNMPVAAREA

SIYTG GITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPAD DSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGA AVSPPGGDFSD

PVTSATLGIVQ VFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGK - UNI3861 - ASLAETD

KITLEVAKLIKDDFLQQNGYTPYDR RFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFK DPVKDGEAKIKADYA

QLLEDMQNAFRSLED
Transcript ENSMUST00000114666
Sequence
AGTGACAGAGCCTCTGGGTCCCGTCTAGGTACACTTTCTGCATTTCGAGCCCGGGCAG - UNI22635 - - UNI29730 - GTAAATTTAACACAA

TGGATTTCTCCAAGCTACCCAAAATCCGAGATGAGGATAAAGAAAGTACATTTGGTTATGTGCATGGAGTCTCAGGGCCTG - UNI17927 - - UNI

22635 - - UNI29730 - TGGTTACAGCCTGTGACATGGCGGGCGCTGCCATGTACGAGCTGGTGAGAGTGGGGCACAGCGAGCTGGTTGGAGAAAT

TATTCGATTGGAAGGTGACATGGCCACCATTCAGGTGTATGAAGAAACTT CTGGTGTCTCTGTTGGAGACCCCGTACTCCGCACTGGTAAACCTCTCTC

GGTCGAGCTGGGTCCCGGGATTATGGGAGCCATTTTTGATGGTATACAGAGACCTCTGTCGGATATCAGCAGTCAGACCCAAAGTATCTACATCCCCAGA

GGAGTCAATGTGTCTGCTCTCAGCAGAGATATCAAATGGGAGTTTATACCCAGCAAAAACCTACGG GTTGGTAGTCATATCACTGGTGGAGACATTTAT

GGGATTGTCAATGAGAACTCCCTCATCAAACACAAAATCATGTTGCCCCCACGTAACAGAGGAAGCGTGACTTACATCGCGCCGCCTGGGAATTATGATG

CATCC GATGTCGTCCTGGAGCTTGAGTTTGAAGGTGTGAAGGAGAAGTTCAGCATGGTCCAAGTGTGGCCTGTGCGGCAGGTGCGGCCTGTCACTGAGA

AGCTGCCCGCCAATCACCCCTTGCTTACTGGCCAGAGAGTCCTCGATGCCCTTTTCCC GTGTGTTCAGGGAGGAACTACTGCTATCCCAGGCGCCTTTG

GCTGTGGAAAGACTGTGATTTCCCAGTCTCTATCCAAGTACTCCAACAGTGACGTCATCATCTATGTCGGCTGCGGTGAGAGAGGCAACGAGATGTCAGA

AGTTCTCCGCGACTTCCCTGAG CTCACCATGGAGGTTGATGGGAAAGTAGAGTCCATCATGAAGAGGACAGCGCTGGTAGCCAACACCTCCAACATGCC

TGTGGCTGCGAGAGAGGCCTCCATCTACACTG GAATTACACTATCAGAATATTTCCGTGACATGGGCTACCACGTCAGTATGATGGCCGACTCTACCTC

TAGATGGGCTGAGGCCCTCAGAGAAATCTCTGGTCGCTTAGCTGAGATGCCTGCAG ATAGTGGATACCCTGCATACCTTGGTGCCCGGCTGGCTTCTTT

CTATGAGCGAGCAGGCAGAGTGAAATGTCTCGGAAACCCTGAGAGAGAAGGGAGTGTCAGCATTGTAGGAGC AGTTTCTCCACCTGGTGGTGATTTTTC

TGATCCAGTCACTTCTGCAACGCTGGGTATTGTTCAG GTGTTCTGGGGCTTGGATAAGAAGTTAGCTCAGCGCAAGCACTTCCCCTCTGTCAACTGGCT

CATCAGCTACAGCAAGTACATGCGTGCCCTGGACGAGTACTATGACAAGCACTTCACGGAGTTTGTTCCTCTGAGGACCAAAGCTAAGGAGATCCTGCAG

GAAGAAGAGGATCTGGCAGAAATCGTGCAGCTCGTGGGAAAG - UNI3861 - GCCTCTTTAGCAGAGACGGATAAAATCACTCTGGAGGTAGCAAAA

CTTATTAAAGATGACTTCCTACAGCAAAATGGGTACACTCCTTATGACAG GTTCTGTCCATTCTACAAGACAGTGGGGATGCTGTCCAACATGATTTCA

TTCTATGACATGGCCCGCCGAGCTGTGGAGACCACTGCCCAGAGTGACAATAAGATCACATGGTCCATTATCCGGGAGCACATGGGGGAGATTCTCTATA

AACTCTCCTCCATGAAATTCAAG GATCCAGTGAAAGATGGCGAGGCAAAGATCAAGGCCGACTATGCACAGCTTCTTGAAGATATGCAGAATGCATTCC

GTAGCCTTGAAGACTAGAACTGTGATTTCTTCCCTCTTCCACGGCAAGCTCATACGTGTATATTTTCCTGAATTTCTCATCTCCAACCCTTAGCTTCCAT

ATTGTGCAGCTTTGAGACTAGTGCCTATGTGTGTTCTTGTTCATTTTGCTGTTTCTTTGGTAGGTCTTATAAAACAAACATTCCTTTGTTCCAGTGTTTG

AAGGAGCTAGCTCCCTTACCTTTATCTGAAGTGGTGAATGTAGTGCATATGATATACATTGTAAGATACACATTGTAACATGATCCATACTGTAAACTTG

TATGTAAGGTGACTACCCCTTCCCTCATCTCCAGTAAACTGTAAACAGGACTACTGCATGTACTCTGTTGGGAATGGAAGGCCAGAACTCCATACCGTGG

ATGGATGGGTACTTAGGAAACAACTCAGCATTTGTAGTCAGACCACTTGTAACTTAGTGGTTTGTTGAGTAACCATTTTGCAGGAAATACTTCCATTTAA

AAACATAAAAGATTAATGTTCCAATTATTTGTATCAATCAGGACCATTTTTGTGGGGCACTTGGGAACTATTTGTTTTTCAAACAGACATTTGCAAGACT

GAACATAATAGATAAATCAGTTACCTCTGAAAATGTGAAAGAAAGGAAAAAAAAAAGAACCAGGTGGTCAAACTTAAATTGACATCATCTTGTTAAAGCA

TATTTTATTTCACTAAGAGAAATTTAATATCAGAGACTTTTATATACTCAATTACTAGAAAACCTTTTTTTTAAGTACAATTTAAAAATCATTGAAAATG

TGATCCACATCATAGCCATTCTTTTCCTCAGACTTAGTCAGACAAGCTTCTCAGAGTGGTGGGATGGGGATTAGAATACCACAGACACTCTGCAGTGCCT

GCAGGCAGTCGGCCCCAGGACAACCACTGCTGTAGGAGTTTGGGGCCAGGGTGGCATGGTTTTCACAAGGTACACGTGTCACGTGTTTGTTTGCCTGTTG

ACATTCTGAAAACAGCAAGTTTACCAATTGCAGAAAATACTTTCTGTTTTCTCTTTCACATGCTCAGAAAGCTTCTCAAAGGTATCTGGTCACAGCAGCT

TCCTTCCTGTTATAGAGGTAAAAGGTGTTCTTATATTTAACTGGTAACAAAAGAAAAAAGAAAAAAGAAAAGATCAATTTTTGTCTTGATGTTTCAGTGT

GTTTAAATAATAATTCCCATACTTGCTTAATAAGGCTCGCTTCAGAGAGCTTGGCGAGCGAGCTCCCTGTTCACTCTCTCCAGCTGATAGTGCTGTCAGT

ATACACTTCAGATGTAATGTGTAAATCCTTGCTGGTGCATGTCTACACAGTGGACTGCTGCTGAAGAAGGATATTCTTCCAATTATTGAACACTGTTGAC

AGATATGGATTATGCAATGGCTTGTTGGGAGGTGGATTAGTGGTGCTGCTTAATCGGTTTGCTTCCAATGTGGCTTCGTATCCAGGAGCCCTGACTAGCG

GAGATGAGAAAGATTTCAAAACCTGTCTGCTTATACCTACCAGCAACCTAGGCTTGTGATCAGAATGAATGATCCCAAGAAACTACTTGACCAAGTTTGT

TTTTGTTGTCCTGGATTCGAGATGTGTTTTCTTCCTTGCTCTAAGACTGTTGATGTATGAGTGTGAAGAGGCTACAGAAACAATGCCCAGATTTTCACTG

TAACTTTCCCTTTGCCCACACTGTAGAACTTGAGATTGTTCACTGATAGTGCGTCTTTAGTAAGGATGTGTTAAAATATAGCAGTCTTTTTAAAAGATTA

TGCAGTTCTCTATTTATTGTGCTGTGCCTGGTCCTAAGTGCAGCCGGTTAAACAAGTTTCATATGTATTTTTCCAGTGTTAAATCTCATACCTATTCCCT

TTGGAAACTTCCATCCTGAACAATGAATAGAAGAGGCTATATAAATTGCCTCCTTATCCTTAAGATTTCACTATCTTTATGTTAAGAGTAATGTATAATT

ATTAAAATCTATGAAAAATAAAAAGTGGATTTAAATT
Translation
 - UNI22635 - - UNI29730 - MDFSKLPKIRDEDKESTFGYVHGVSGPV - UNI17927 - - UNI22635 - - UNI29730 - VVTAC

DMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETS SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPRGVNVSALSRD

IKWEFIPSKNLR VGSHITGGDIYGIVNENSLIKHKIMLPPRNRGSVTYIAPPGNYDAS DVVLELEFEGVKEKFSMVQVWPVRQVRPVTEKLPANHPLL

TGQRVLDALFP PCVQGGTTAIPGAFGCGKTVISQSLSKYSNSDVIIYVGCGERGNEMSEVLRDFPE LTMEVDGKVESIMKRTALVANTSNMPVAAREA

SIYTG GITLSEYFRDMGYHVSMMADSTSRWAEALREISGRLAEMPAD DSGYPAYLGARLASFYERAGRVKCLGNPEREGSVSIVGA AVSPPGGDFSD

PVTSATLGIVQ VFWGLDKKLAQRKHFPSVNWLISYSKYMRALDEYYDKHFTEFVPLRTKAKEILQEEEDLAEIVQLVGK - UNI3861 - ASLAETD

KITLEVAKLIKDDFLQQNGYTPYDR RFCPFYKTVGMLSNMISFYDMARRAVETTAQSDNKITWSIIREHMGEILYKLSSMKFK DPVKDGEAKIKADYA

QLLEDMQNAFRSLED

For any suggestions or comments, please send an email to unitrap@crg.es