Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052516 (Robo2)
Chromosomal location
Chr 16: 73892551 - 74412030 (-)
Description
roundabout homolog 2 (Drosophila) Gene [Source:MGI (curated);Acc:Robo2-004]
RefSeq_peptide
NP_780758.3 
UniGene
Mm.410124 Mm.437237 Mm.171736 
MGI
MGI:1890110 
Uniprot/SWISSPROT
Q7TPD3 
Uniprot/SPTREMBL
Q3V357 Q19AB2 Q19AB3 
Human Ortholog
ENSG00000185008 (ROBO2)
Omim 610878 - VESICOURETERAL REFLUX 2  
UniTrap UNI38377
Vector Insertion
Chr 16: 74352795 - 74411158
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38422
Vector Insertion
Chr 16: 73996817 - 74009032
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15643
Vector Insertion
Chr 16: 73899156 - 73904802
Public Clones PST9026-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14030
Vector Insertion
Chr 16: 73896076 - 73897251
Public Clones CMHD-GT_152E12-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116586
Sequence
ACTACTCCCGGAGGCTGGACCACGCGTGAGCATCCTCAGGGCTCCCAGGTCCGGAGCTCCTAGATCTGGCGGTGCTCGCCAGCAGCAGCTGGACGCTAGA

TCTCTCCGGGGCGGCCCCTCCCGGGTGGCCGCGGCCTCAGCTCAGCCCCTCCCTCTTCCCTTGCTTCTTCTCCTCGCCCTCCTCCTCGCTCCCTCACCAC

GTAGGAGTTCCCATTCTCCACCCAAGCCGTCCTGCCTTCCCCTTTTCCTTCCTTTTGGAAACCAGAGACTCCGAGGGAGGCGACCAGGCTGCGGAGGAGA

GGGCCGGCTCACAAAGTGCTGCTTTGACACATCCTTAGGATGGAAGTTAAGTGAAAACAGAACCACACAAAACAAAACTCCGCGAAGTGGTGCTGCTACG

GAGGAAACCAAGGGGAGAAAAACCCGGTGGGCAGGTCAATGGTTGCTTCGCAGCGCTTTGGCAAGTTTGTGGAACACTTTCTAGGAATTAGGTCTTTTTT

GTACCCCCATCATCTTCTTGACTTCCGAAGAAAGAAGTTGTGTTTGGATTGCAATGGAGTCTAAGGAGACAGGGCTAGACGCACGTGAATAGTCCCGCCA

GCTGGGCTGAATTTGTGGGAATTTAGAAAGACAGCCTGTGGAAGTGCAACGTCTCTGAAGTCCCCTGGGTTCATTCGGATGGCACCTAACGCGTCCCGTG

ACAGACCTCTTCACCAACAGCTTCCGATGTTGCCATTTTGCTCTTCTTGACCTTAATTAATCTCTAGGAAAGTCTAAACTTCGGACCTACCTCTTTTTTT

GATACTTATTTTTGTACTTCTGCTCTCTGGGATTGGTTTCTTAAACAACCTGGATCCTTTTTCATATGTCAAAATGAATCCTCTGATGTTTACACTATTA

TTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGTCATCGTC

TCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGGGTGGAGACAGACAAGG

ATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGAGTTACGT

TTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGATGACTTCCGGCAAAACCCCACAGATGT

GGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGAT

GACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATG

GTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCT

GTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGAT

GACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCC

TCACTGTCCGAG TATTTCAAGTCT CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAA

ACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCA

GTGTCGCCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTA

AAGCACAGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCAT

TGTTGAAGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGA

CCAAGGAACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGT

GCTGGATGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAA

GAACAGTGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTG

GCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAA

GGTCTCAGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTA

GGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGC

TACAGAGTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGA

ATTTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGA

AG CCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCA

CCAGAATGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGT

AATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATT

G GGGGACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGT

GGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGA

GGAGATGGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGT

TTGCCAGTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCG

ACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCA

CTACACAAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGG

ATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAA

CGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTA

TGACAGTGACAGCTGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCT

CCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGC

AAGCTCACTTGGATGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATGGTAAATATCCTCCATAAACCAATGGCCCTGTACTTTCTACAT

ATGGAGATTTTCTTGCATGTATATTAAGTAGAGATGCTCATAAATCTATGTGAGTGGAATGAAAATTGATTTTGAATATGTGTTAACCATCCATATTAAG

AAACTGGTGACAGAAACATACGTAAACTGGCCATCATCGCACAGCTAGCTAGAGAAGTGAATGGAGCAGGGACTCAGGCTGAGTGTTTTGGTGACACCAG

ATTCTTTTCTCATTCACAGACCAGCGTTCATTAGTTTATCCTTGAACTCATTTTTAATGCTGCAATAAAGAACTCCTTTTAAATTC
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRV VFQVS SPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQ

RSDAGYYICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR 

ISDTGTYTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHV

KTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMY

RQTSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNG

IIQEYK IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGG

ACWVILMGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQG

DKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGKKKKTKNSS

KAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPR

EEMQPMLQAHLDELTRAYQFDIAKQTW
Transcript ENSMUST00000089242
Sequence
ACTACTCCCGGAGGCTGGACCACGCGTGAGCATCCTCAGGGCTCCCAGGTCCGGAGCTCCTAGATCTGGCGGTGCTCGCCAGCAGCAGCTGGACGCTAGA

TCTCTCCGGGGCGGCCCCTCCCGGGTGGCCGCGGCCTCAGCTCAGCCCCTCCCTCTTCCCTTGCTTCTTCTCCTCGCCCTCCTCCTCGCTCCCTCACCAC

GTAGGAGTTCCCATTCTCCACCCAAGCCGTCCTGCCTTCCCCTTTTCCTTCCTTTTGGAAACCAGAGACTCCGAGGGAGGCGACCAGGCTGCGGAGGAGA

GGGCCGGCTCACAAAGTGCTGCTTTGACACATCCTTAGGATGGAAGTTAAGTGAAAACAGAACCACACAAAACAAAACTCCGCGAAGTGGTGCTGCTACG

GAGGAAACCAAGGGGAGAAAAACCCGGTGGGCAGGTCAATGGTTGCTTCGCAGCGCTTTGGCAAGTTTGTGGAACACTTTCTAGGAATTAGGTCTTTTTT

GTACCCCCATCATCTTCTTGACTTCCGAAGAAAGAAGTTGTGTTTGGATTGCAATGGAGTCTAAGGAGACAGGGCTAGACGCACGTGAATAGTCCCGCCA

GCTGGGCTGAATTTGTGGGAATTTAGAAAGACAGCCTGTGGAAGTGCAACGTCTCTGAAGTCCCCTGGGTTCATTCGGATGGCACCTAACGCGTCCCGTG

ACAGACCTCTTCACCAACAGCTTCCGATGTTGCCATTTTGCTCTTCTTGACCTTAATTAATCTCTAGGAAAGTCTAAACTTCGGACCTACCTCTTTTTTT

GATACTTATTTTTGTACTTCTGCTCTCTGGGATTGGTTTCTTAAACAACCTGGATCCTTTTTCATATGTCAAAATGAATCCTCTGATGTTTACACTATTA

TTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGTCATCGTC

TCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGGGTGGAGACAGACAAGG

ATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGAGTTACGT

TTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGATGACTTCCGGCAAAACCCCACAGATGT

GGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGAT

GACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATG

GTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCT

GTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGAT

GACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCC

TCACTGTCCGAG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACC

CACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGG

GGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGA

AGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAA

AGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTG

CAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACA

G AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACC

TTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCA

AACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATC

CAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTG

TTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGT

ACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGG

GGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGC

CCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATT

ATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTG

TTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAAC

GAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGG

TAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGAC

TAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACA

ATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGG

ATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCT

GCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCG

CTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGG

GCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGC

TGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCG

TGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGA

TGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATGGTAAATATCCTCCATAAACCAATGGCCCTGTACTTTCTACATATGGAGATTTTCT

TGCATGTATATTAAGTAGAGATGCTCATAAATCTATGTGAGTGGAATGAAAATTGATTTTGAATATGTGTTAACCATCCATATTAAGAAACTGGTGACAG

AAACATACGTAAACTGGCCATCATCGCACAGCTAGCTAGAGAAGTGAATGGAGCAGGGACTCAGGCTGAGTGTTTTGGTGACACCAGATTCTTTTCTCAT

TCACAGACCAGCGTTCATTAGTTTATCCTTGAACTCATTTTTAATGCTGCAATAAAGAACTCCTTTTAAATTC
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGY

YICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR ISDTGT

YTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHVKTTLYT

VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMYRQTSGL

QASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYK

 IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVIL

MGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQGDKTATM

LSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGKKKKTKNSSKAQKNN

GSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPM

LQAHLDELTRAYQFDIAKQTW
Transcript ENSMUST00000064435
Sequence
ATGAATCCTCTGATGTTTACACTATTATTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATC

GTAGAACACCCTTCTGATGTCATCGTCTCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGG

ATGGTGAGAGGGTGGAGACAGACAAGGATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAG

AAGTAAACCGGACGAAGGGAGTTACGTTTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGA

TGACTTCCGGCAAAACCCCACAGATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTAC

TGGAAAAAGGACAAAGTCCGAATTGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGC

ATGTACACCTGTGTGGGAACCAATATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATT

AACCAGGTGGTGCTAGAGGAAGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGC

CGAGAGGAAG GTATGATATCAAAGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGG

TGGGAAAAGTGGAAGCCTCTGCTACCCTCACTGTCCGAG GGAGAAACCAAA CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAA

GGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAA

CCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCC

TAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACC

AAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGG

GAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTC

CAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATC

CAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCT

TTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTG

TTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTG

GACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTG

GACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCC

CGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGA

ATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGT

TTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAAC

GGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTA

AAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAG

CAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCA

GCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGG

CTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCG

GTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCC

AAATAACACAGGCCACCCCATATGCCACTACACAAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTC

AGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAA

AAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCAC

TATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGCTGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAA

GAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCC

CACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATG GCACATTCAAAGCA

ATACCCCACCTCCACAACCCCCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGATGAGGATGCTGATGA

TGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGATCCAGTATGGACAATCTAGACAGCTCTGTCACAG - UNI15

643 - GAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCACCAGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCC

TCGGCCCACGAAAAAACATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATG - UNI15643 - ATCTTC

CCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAACACTCTGGTAACGTGGAAAACTCAACAGAGAGAAAAGGAAG

CTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGACACAAAGAGCTCATTGGATTGTCCAGCTAAAACTGTTCTAGAGTGGCAGCGTCAAACCCAGGAC

TGGATAAACTCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGTTGGATCAG - UNI15643 - AGGAGTCCCTGGTGCCCTA

CAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAAGGGTCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGC

AGCCACCAGAGGAATGCCAATGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCAAGGACAGTTTACAGGT
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRG GRNQT TPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQ

RSDAGYYICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR 

ISDTGTYTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHV

KTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMY

RQTSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNG

IIQEYK IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGG

ACWVILMGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQG

DKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGKKKKTKNSS

KAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPR

EEMQPMLQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTG -

 UNI15643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDD - UNI15643 - DLPPPPDPPPGQGLR

QQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQDWINSTERQEETRKAPHKQGVGSE - UNI15643 - EESLVPYSK

PSFPSPGGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTG
Transcript ENSMUST00000117200
Sequence
CTTTTTTGTACCCCCATCATCTTCTTGACTTCCGAAGAAAGAAGTTGTGTTTGGATTGCAATGGAGTCTAAGGAGACAGGGCTAGACGCACGTGAATAGT

CCCGCCAGCTGGGCTGAATTTGTGGGAATTTAGAAAGACAGCCTGTGGAAGTGCAACGTCTCTGAAGTCCCCTGGGTTCATTCGGATGGCACCTAACGCG

TCCCGTGACAGACCTCTTCACCAACAGCTTCCGATGTTGCCATTTTGCTCTTCTTGACCTTAATTAATCTCTAGGAAAGTCTAAACTTCGGACCTACCTC

TTTTTTTGATACTTATTTTTGTACTTCTGCTCTCTGGGATTGGTTTCTTAAACAACCTGGATCCTTTTTCATATGTCAAAATGAATCCTCTGATGTTTAC

ACTATTATTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGT

CATCGTCTCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGGGTGGAGACA

GACAAGGATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGA

GTTACGTTTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGATGACTTCCGGCAAAACCCCA

CAGATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCG

AATTGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAAC

CAATATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGA

AGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAG GTATGATAT

CAAAGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCT

GCTACCCTCACTGTCCGAG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAA

GGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCG

CCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCAC

AGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGA

AGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGG

AACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGA

TGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAG

TGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGAC

AGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTC

AGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGAT

GTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGA

GTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGA

AAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCC

CAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAA

TGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGG

TGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGG

ACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCC

TGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGAT

GGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCA

GTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATG

CTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACAC

AAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGG

TTATTCGCTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATC

CACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAG

TGACAGCTGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTT

CGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTC

ACTTGGATGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATG GCACATTCAAAGCAATACCCCACCTCCACAACCCCCAGCTCCGCCAT

TAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGATGAGGATGCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCT

CAGAGCACTAGACCAGACACCTGGATCCAGTATGGACAATCTAGACAGCTCTGTCACAG - UNI15643 - GAAAAGCCTTTAGCTCCTCTCAAAGGC

AGCGGCCCACCAGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCACGAAAAAACATAAGGGAGGACGGAT

GGACCCACAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATG - UNI15643 - AGGAGTCCCTGGTGCCCTACAGCAAGCCCAGCTTCCCGT

CTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAAGGGTCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAA

TGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCAAGGACAGTTTACAGGTGAATTGT - UNI14030 - AGTAACTGAGAGGGGACATACAAA

GATGCTCTGAGGACCATCAGGTCCAAACTCATGGAAGTGATAACATTTAACAGTGCAATGAACAATTTCTTTATTTATGTACTATTAAAAAAAAACTGTA

AATGCAATGTAAAGACACACAGCCACACATATTCCACAGTTATTTTCTTGTGTTCTTCTCTTACTTACACCACCCACCTTAACTCTTTCTTGTCAGGAGT

ATATAAGAAAAAGAAAGAAAGCAAAACTCACCCTCCAGGAAGAAAAGGATTTTTCCTCTGTATATAATTTCTTTTGTGCATTGCTATGCAAGCTCACTCT

TTTTAACTCTGTTCATATTATTGTCTGTTCTGATTGGTCTGTTGTACTATATGTGAATTAATGGGCTGTGGTGCCATATATTAACTTTTAATTGTGTAAC

TTTTTATGTTTAAATTTTGCACTGCGATTTTATTTGGTGATAAGCACAAATCTCTACTCCTCATGACATGAAGAAAAGATTGAATGTGAAGGGAGTTTTC

TGTACTGTAAGTTAGGTTGGATAATGCTGGTGTAACCAATCCAGTTAGATGGTTTTCAGTTGGGGGTGTAGAAATAGGAAGATCGAAGGAATGATGGTGT

TGGCAAAGTCTTCTTGAAACAACAGATATTGAGACAATTTTAAGAAGCAGAAAGATGGATACTATTGACTAAAGCAGGGGTCAAAAGAAGGGGGTTTAAG

TCTAGACAGAGTATGTAATAAAGTATGGTGGTAGCAAAGATGTACTAACTTGCTTTAAAAATATTATTAAAGTTTTATTTAGAATGAACTTTACCTGCCA

TTGTAATTAACCCATCTTAGAATTACAATGAGCAAAATAAAAATCAAGGTGTTTCAAGAGATCTGTATTTATATTACAGCTTTTTAAAAACAGCAGTTTT

GAATAATCATAATTAATCTCTCCAACTCATTAAGTCAGACTATAACATGGAGTTCCCCAAGGAAACAAACAAAAAAAATGAACTCCAGAAACTCTAGCAA

ATAGTTAAAGAAGCAACTTATTCTTCGAGCATACTCGGCTACTCTTGAATATGAGCTCAATTGCAATATCTTGTTCATCTTTCTAATACATGTACAGTAC

ATATTAGAGGATGTAGGCACATCACTTAAGTTCATTTCTTTTTAAAAAAAAAAAGCAAACTAATGCATTCTGCATACAATTTTGTGTTTCTTTTGGTTAA

AATGTGAAATCGATGCCACCAGATGTATAGCCACATTATAAGTGCTTAAAGGCAGTGCTCACAGTATGTTCAGTTTCCAGTTAGTAGATTTATTGGACTC

AATATTTTCTGGTACATTCTCAGAAATTGGCTACCAACTCAAATCTGTTTGACCCATTTTGAATGAGTAAATCGGAAAGAACAGTCAAAAGGGAGAAAAA

AATGCATGTTTATACACTTTTTAAATAAAACCAAATCTTGTAAGTGGACATT
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGY

YICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR ISDTGT

YTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHVKTTLYT

VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMYRQTSGL

QASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYK

 IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVIL

MGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQGDKTATM

LSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGKKKKTKNSSKAQKNN

GSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPM

LQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTG - UNI15

643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDE - UNI15643 - EESLVPYSKPSFPSPGGHSSS

GTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTGEL - UNI14030 - L
Transcript ENSMUST00000114262
Sequence
ACTACTCCCGGAGGCTGGACCACGCGTGAGCATCCTCAGGGCTCCCAGGTCCGGAGCTCCTAGATCTGGCGGTGCTCGCCAGCAGCAGCTGGACGCTAGA

TCTCTCCGGGGCGGCCCCTCCCGGGTGGCCGCGGCCTCAGCTCAGCCCCTCCCTCTTCCCTTGCTTCTTCTCCTCGCCCTCCTCCTCGCTCCCTCACCAC

GTAGGAGTTCCCATTCTCCACCCAAGCCGTCCTGCCTTCCCCTTTTCCTTCCTTTTGGAAACCAGAGACTCCGAGGGAGGCGACCAGGCTGCGGAGGAGA

GGGCCGGCTCACAAAGTGCTGCTTTGACACATCCTTAGGATGGAAGTTAAGTGAAAACAGAACCACACAAAACAAAACTCCGCGAAGTGGTGCTGCTACG

GAGGAAACCAAGGGGAGAAAAACCCGGTGGGCAGGTCAATGGTTGCTTCGCAGCGCTTTGGCAAGTTTGTGGAACACTTTCTAGGAATTAGGTCTTTTTT

GTACCCCCATCATCTTCTTGACTTCCGAAGAAAGAAGTTGTGTTTGGATTGCAATGGAGTCTAAGGAGACAGGGCTAGACGCACGTGAATAGTCCCGCCA

GCTGGGCTGAATTTGTGGGAATTTAGAAAGACAGCCTGTGGAAGTGCAACGTCTCTGAAGTCCCCTGGGTTCATTCGGATGGCACCTAACGCGTCCCGTG

ACAGACCTCTTCACCAACAGCTTCCGATGTTGCCATTTTGCTCTTCTTGACCTTAATTAATCTCTAGGAAAGTCTAAACTTCGGACCTACCTCTTTTTTT

GATACTTATTTTTGTACTTCTGCTCTCTGGGATTGGTTTCTTAAACAACCTGGATCCTTTTTCATATGTCAAAATGAATCCTCTGATGTTTACACTATTA

TTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGTCATCGTC

TCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGGGTGGAGACAGACAAGG

ATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGAGTTACGT

TTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGATGACTTCCGGCAAAACCCCACAGATGT

GGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGAT

GACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATG

GTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCT

GTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGAT

GACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCC

TCACTGTCCGAG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACC

CACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGG

GGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGA

AGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAA

AGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTG

CAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACA

G AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACC

TTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCA

AACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATC

CAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTG

TTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGT

ACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGG

GGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGC

CCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATT

ATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTG

TTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAAC

GAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGG

TAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGAC

TAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACA

ATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGG

ATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCT

GCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCG

CTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGG

GCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGC

TGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCG

TGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGA

TGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATG GCACATTCAAAGCAATACCCCACCTCCACAACCCCCAGCTCCGCCATTAGGTTA

CGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGATGAGGATGCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCA

CTAGACCAGACACCTGGATCCAGTATGGACAATCTAGACAGCTCTGTCACAG - UNI15643 - GAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCC

CACCAGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCACGAAAAAACATAAGGGAGGACGGATGGACCCA

CAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATG - UNI15643 - ATCTTCCCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCA

GCAGATAGGCCTGAGCCAACACTCTGGTAACGTGGAAAACTCAACAGAGAGAAAAGGAAGCTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGACACA

AAGAGCTCATTGGATTGTCCAGCTAAAACTGTTCTAGAGTGGCAGCGTCAAACCCAGGACTGGATAAACTCTACAGAACGCCAAGAAGAAACTCGGAAAG

CCCCACACAAACAAGGGGTTGGATCAG - UNI15643 - AGGAGTCCCTGGTGCCCTACAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCA

TCAGGAACATCTTCCTCTAAAGGGTCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAATGACCTTCTCGACATTGGAT

ATGTGGGCTCAAATAGTCAAGGACAGTTTACAGGTGAATTGT - UNI14030 - AGTAACTGAGAGGGGACATACAAAGATGCTCTGAGGACCATCAG

GTCCAAACTCATGGAAGTGATAACATTTAACAGTGCAATGAACAATTTCTTTATTTATGTACTATTAAAAAAAAACTGTAAATGCAATGTAAAGACACAC

AGCCACACATATTCCACAGTTATTTTCTTGTGTTCTTCTCTTACTTACACCACCCACCTTAACTCTTTCTTGTCAGGAGTATATAAGAAAAAGAAAGAAA

GCAAAACTCACCCTCCAGGAAGAAAAGGATTTTTCCTCTGTATATAATTTCTTTTGTGCATTGCTATGCAAGCTCACTCTTTTTAACTCTGTTCATATTA

TTGTCTGTTCTGATTGGTCTGTTGTACTATATGTGAATTAATGGGCTGTGGTGCCATATATTAACTTTTAATTGTGTAACTTTTTATGTTTAAATTTTGC

ACTGCGATTTTATTTGGTGATAAGCACAAATCTCTACTCCTCATGACATGAAGAAAAGATTGAATGTGAAGGGAGTTTTCTGTACTGTAAGTTAGGTTGG

ATAATGCTGGTGTAACCAATCCAGTTAGATGGTTTTCAGTTGGGGGTGTAGAAATAGGAAGATCGAAGGAATGATGGTGTTGGCAAAGTCTTCTTGAAAC

AACAGATATTGAGACAATTTTAAGAAGCAGAAAGATGGATACTATTGACTAAAGCAGGGGTCAAAAGAAGGGGGTTTAAGTCTAGACAGAGTATGTAATA

AAGTATGGTGGTAGCAAAGATGTACTAACTTGCTTTAAAAATATTATTAAAGTTTTATTTAGAATGAACTTTACCTGCCATTGTAATTAACCCATCTTAG

AATTACAATGAGCAAAATAAAAATCAAGGTGTTTCAAGAGATCTGTATTTATATTACAGCTTTTTAAAAACAGCAGTTTTGAATAATCATAATTAATCTC

TCCAACTCATTAAGTCAGACTATAACATGGAGTTCCCCAAGGAAACAAACAAAAAAAATGAACTCCAGAAACTCTAGCAAATAGTTAAAGAAGCAACTTA

TTCTTCGAGCATACTCGGCTACTCTTGAATATGAGCTCAATTGCAATATCTTGTTCATCTTTCTAATACATGTACAGTACATATTAGAGGATGTAGGCAC

ATCACTTAAGTTCATTTCTTTTTAAAAAAAAAAAGCAAACTAATGCATTCTGCATACAATTTTGTGTTTCTTTTGGTTAAAATGTGAAATCGATGCCACC

AGATGTATAGCCACATTATAAGTGCTTAAAGGCAGTGCTCACAGTATGTTCAGTTTCCAGTTAGTAGATTTATTGGACTCAATATTTTCTGGTACATTCT

CAGAAATTGGCTACCAACTCAAATCTGTTTGACCCATTTTGAATGAGTAAATCGGAAAGAACAGTCAAAAGGGAGAAAAAAATGCATGTTTATACACTTT

TTAAATAAAACCAAATCTTGTAAGTGGACATTAATAACAGTGTCCTGCCTCATTTGTTTTCACGACTCTGAGAACAAGGAGTTGCTCAACATCCATTATG

TATGCTCAAGATAAATGTGACTTTGAAATGTATGTTAGCTACTGTACATGTATGTAAGTCAAGTAGATGATAGCCTTCCTGAAACTACCACTAATAATAT

TTTCCCATGTGCTACTTACACAAGCTTAAATTCTAGTTCAGCAAATGTTTTTCATTATTTTTTCTTACGGTTTATTCAATAGAGGGTACCTAGAAAAATA

TTCAGTGTGATGGTCAACATATTGAGTGTTCAAGTAGGGGATATTTACTTTGGCAATACATACTGTGCATTATTGGTTCAGATGCCAATTCATGAGACAT

TATCATAGGAAATGGATAATATAAGAACATGGCTCTAAGGGTCCTTCTCCACAGGCAAGCATAGAATTTGAGGTTCTTCATGGGTCCCAAAACTTGCTTA

GTGTTATATACTTAACTTCCTTCACTGAAGTATCAAGCAATTCTAACACACCGTTTAACAACTTTCTACCATCAGTGCCTGCATTTTATTGAAGTTTGAT

GTCTCTGGTACAAGGAAATAGAGAAAGCTGAACAGTTTCTGTTGGGAGAAAAAGTTTCTGTAATTATTGTCAATTCTAAGTTGTGATGAATATAACTTTT

CATCTATACAGTTCCTTACTCATGGTCTCTATTTAAAAGCATAGGATCTTTTAAGATATACTTTTAGCTGAGTCTTCACTGTATGTTCATGAATAATATA

ATTTAGTGAAAAACTTTAGTACATCATATGTATGGTAACTGACATTTGCAGATTATTATCAAACCAAATCATAAGAAATAATATCTTCAGATCACATGAT

GGCTTACCGAACAATTTCAGGTTATAGCATGATGTCTTTCTGATTGTCTTCAGTATATGATCATAAGCAATTATATTGTGTCCATACAGTTTACATACTG

TGATTCCCGCAAAATCTTGCATCTGATATCTACCATGAAGATGAAATAATATGCTATGAATTTCAGGCATAGACATACTATCAGCAATAGAAAGCCTTCA

TCATCTAGATATCTGGATAAATCCATTCATCGTCAACCATCAGATTGTTAACTGGGGAACACGTACCTCCCTCACAAATGCTTTCTTTTCGTCTTGTAGT

TGATTGAATGTGATAGGAAATCTGCTGAGTTGACTCTTCTGTGGGCCTGAGCAGAAACATGCATAAGCCATCAGAAGGAAGTCTGGATGGGAAGGAAACC

TTGTCTTTCACTCGTAGGCAATACTGCTGTGTAGTCACGGCAGACCCAAGCACAGCTTCTTTCAGAACATGCAAAGTCTCCTTATGAAATATACACATCA

GTGCCCAAACTCAGGTGTACCAGTGTAAAGCGTAGGGTTTGCCTACCCTTTTTTCATATCATTTTACATAAGCAAGTTAGGAGACTACAGGGCTATGAAA

ATAAATGTTTCCTTAACAGGATTTGGAGCAAGTTCACGGGAGTACATAGGACAGTCGAGCCCAGTGTAAACACTACCAAAGGAAAGGACAGCCTTGCAGA

AGCGTGAGCTCCGACTAACAGAGCGGCTTAAGTATGCTCTGTGATACAGCTTAATGCACTCCCTATTCAAATCCCACTGTCAATGGGATTTAAGTTGCCA

GTTTATATGTGATTTCATGGAACACAACCAAGTTCTACTTAATACCTTTATGCAATTTTTTTTTCACTGATGAAAAATCAATATCCACATCAATGGGTGC

CCAGCTGCGGATCACCTCTCCTAAAAAGCGATCTTGTCAGTATTGAAGAAATGTAGAACCATAATTTTCACTACTAATATCATTTTGCTCAACTACTTCT

GTATATTGTGGAAAAAGGGGTGGGGCCGGGGGAATGTGTGTTTCCACATTTTCTGAGAGGTGAAAATATTTTTGTGTTGCTTTGTCCTAATGGGTACTTC

AAATGAAACACCATACAATTTTAAATGACATGCAATTAACGAATATTTTTTACTCTCATAACATTAAAAGCATTTGTTGTG
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGY

YICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR ISDTGT

YTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHVKTTLYT

VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMYRQTSGL

QASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYK

 IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVIL

MGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQGDKTATM

LSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGKKKKTKNSSKAQKNN

GSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPM

LQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTG - UNI15

643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDD - UNI15643 - DLPPPPDPPPGQGLRQQIGLS

QHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQDWINSTERQEETRKAPHKQGVGSE - UNI15643 - EESLVPYSKPSFPSP

GGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTGEL - UNI14030 - L
Transcript ENSMUST00000114263
Sequence
TCAGTATTGCGAGATGACTTCCGGCAAAACCCCACAGATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAG

AACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGA

AAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTC

TCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGA

TGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTAT

TGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCCTCACTGTCCGAG TTCGCCCTGTTG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATC

AGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTAC

TTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTA

CATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCA

AGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGC

TTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGT

GTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTC

CCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGT

ATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCA

ACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCC

CAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGT

CACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCT

AGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAA

GGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGC

ACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTC

CATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTG

CAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCA

CGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAA

GAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATC

CCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG 

ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTA

CAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCA

CAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACG GTGGGAAAGGTGGAAAA

AAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTA

CAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGCTGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGG

AAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCAC

TCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATG 

GCACATTCAAAGCAATACCCCACCTCCACAACCCCCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGAT

GAGGATGCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGATCCAGTATGGACAATCTAGACAGCTCTG

TCACAG - UNI15643 - GAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCACCAGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAAT

CAAAGCCAGAGGCCTCGGCCCACGAAAAAACATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATG - UNI

15643 - ATCTTCCCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAACACTCTGGTAACGTGGAAAACTCAACA

GAGAGAAAAGGAAGCTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGACACAAAGAGCTCATTGGATTGTCCAGCTAAAACTGTTCTAGAGTGGCAGC

GTCAAACCCAGGACTGGATAAACTCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGTTGGATCAG - UNI15643 - AGGAG

TCCCTGGTGCCCTACAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAAGGGTCCACTGGCCCTCGGAAGGCTG

ACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAATGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCAAGGACAGTTTACAG - UNI14030 -

 AGTAACTGAGAGGGGACATACAAAGATGCTCTGAGGACCATCAGGTCCAAACTCATGGAAGTGATAACATTTAACAGTGCAATGAACAATTTCTTTATT

TATGTACTATTAAAAAAAAACTGTAAATGCAATGTAAAGACACACAGCCACACATATTCCACAGTTATTTTCTTGTGTTCTTCTCTTACTTACACCACCC

ACCTTAACTCTTTCTTGTCAGGAGTATATAAGAAAAAGAAAGAAAGCAAAACTCACCCTCCAGGAAGAAAAGGATTTTTCCTCTGTATATAATTTCTTTT

GTGCATTGCTATGCAAGCTCACTCTTTTTAACTCTGTTCATATTATTGTCTGTTCTGATTGGTCTGTTGTACTATATGTGAATTAATGGGCTGTGGTGCC

ATATATTAACTTTTAATTGTGTAACTTTTTATGTTTAAATTTTGCACTGCGATTTTATTTGGTGATAAGCACAAATCTCTACTCCTCATGACATGAAGAA

AAGATTGAATGTGAAGGGAGTTTTCTGTACTGTAAGTTAGGTTGGATAATGCTGGTGTAACCAATCCAGTTAGATGGTTTTCAGTTGGGGGTGTAGAAAT

AGGAAGATCGAAGGAATGATGGTGTTGGCAAAGTCTTCTTGAAACAACAGATATTGAGACAATTTTAAGAAGCAGAAAGATGGATACTATTGACTAAAGC

AGGGGTCAAAAGAAGGGGGTTTAAGTCTAGACAGAGTATGTAATAAAGTATGGTGGTAGCAAAGATGTACTAACTTGCTTTAAAAATATTATTAAAGTTT

TATTTAGAATGAACTTTACCTGCCATTGTAATTAACCCATCTTAGAATTACAATGAGCAAAATAAAAATCAAGGTGTTTCAAGAGATCTGTATTTATATT

ACAGCTTTTTAAAAACAGCAGTTTTGAATAATCATAATTAATCTCTCCAACTCATTAAGTCAGACTATAACATGGAGTTCCCCAAGGAAACAAACAAAAA

AAATGAACTCCAGAAACTCTAGCAAATAGTTAAAGAAGCAACTTATTCTTCGAGCATACTCGGCTACTCTTGAATATGAGCTCAATTGCAATATCTTGTT

CATCTTTCTAATACATGTACAGTACATATTAGAGGATGTAGGCACATCACTTAAGTTCATTTCTTTTTAAAAAAAAAAAGCAAACTAATGCATTCTGCAT

ACAATTTTGTGTTTCTTTTGGTTAAAATGTGAAATCGATGCCACCAGATGTATAGCCACATTATAAGTGCTTAAAGGCAGTGCTCACAGTATGTTCAGTT

TCCAGTTAGTAGATTTATTGGACTCAATATTTTCTGGTACATTCTCAGAAATTGGCTACCAACTCAAATCTGTTTGACCCATTTTGAATGAGTAAATCGG

AAAGAACAGTCAAAAGGGAGAAAAAAATGCATGTTTATACACTTTTTAAATAAAACCAAATCTTGTAAGTGGACATTAATAACAGTGTCCTGCCTCATTT

GTTTTCACGACTCTGAGAACAAGGAGTTGCTCAACATCCATTATGTATGCTCAAGATAAATGTGACTTTGAAATGTATGTTAGCTACTGTACATGTATGT

AAGTCAAGTAGATGATAGCCTTCCTGAAACTACCACTAATAATATTTTCCCATGTGCTACTTACACAAGCTTAAATTCTAGTTCAGCAAATGTTTTTCAT

TATTTTTTCTTACGGTTTATTCAATAGAGGGTACCTAGAAAAATATTCAGTGTGATGGTCAACATATTGAGTGTTCAAGTAGGGGATATTTACTTTGGCA

ATACATACTGTGCATTATTGGTTCAGATGCCAATTCATGAGACATTATCATAGGAAATGGATAATATAAGAACATGGCTCTAAGGGTCCTTCTCCACAGG

CAAGCATAGAATTTGAGGTTCTTCATGGGTCCCAAAACTTGCTTAGTGTTATATACTTAACTTCCTTCACTGAAGTATCAAGCAATTCTAACACACCGTT

TAACAACTTTCTACCATCAGTGCCTGCATTTTATTGAAGTTTGATGTCTCTGGTACAAGGAAATAGAGAAAGCTGAACAGTTTCTGTTGGGAGAAAAAGT

TTCTGTAATTATTGTCAATTCTAAGTTGTGATGAATATAACTTTTCATCTATACAGTTCCTTACTCATGGTCTCTATTTAAAAGCATAGGATCTTTTAAG

ATATACTTTTAGCTGAGTCTTCACTGTATGTTCATGAATAATATAATTTAGTGAAAAACTTTAGTACATCATATGTATGGTAACTGACATTTGCAGATTA

TTATCAAACCAAATCATAAGAAATAATATCTTCAGATCACATGATGGCTTACCGAACAATTTCAGGTTATAGCATGATGTCTTTCTGATTGTCTTCAGTA

TATGATCATAAGCAATTATATTGTGTCCATACAGTTTACATACTGTGATTCCCGCAAAATCTTGCATCTGATATCTACCATGAAGATGAAATAATATGCT

ATGAATTTCAGGCATAGACATACTATCAGCAATAGAAAGCCTTCATCATCTAGATATCTGGATAAATCCATTCATCGTCAACCATCAGATTGTTAACTGG

GGAACACGTACCTCCCTCACAAATGCTTTCTTTTCGTCTTGTAGTTGATTGAATGTGATAGGAAATCTGCTGAGTTGACTCTTCTGTGGGCCTGAGCAGA

AACATGCATAAGCCATCAGAAGGAAGTCTGGATGGGAAGGAAACCTTGTCTTTCACTCGTAGGCAATACTGCTGTGTAGTCACGGCAGACCCAAGCACAG

CTTCTTTCAGAACATGCAAAGTCTCCTTATGAAATATACACATCAGTGCCCAAACTCAGGTGTACCAGTGTAAAGCGTAGGGTTTGCCTACCCTTTTTTC

ATATCATTTTACATAAGCAAGTTAGGAGACTACAGGGCTATGAAAATAAATGTTTCCTTAACAGGATTTGGAGCAAGTTCACGGGAGTACATAGGACAGT

CGAGCCCAGTGTAAACACTACCAAAGGAAAGGACAGCCTTGCAGAAGCGTGAGCTCCGACTAACAGAGCGGCTTAAGTATGCTCTGTGATACAGCTTAAT

GCACTCCCTATTCAAATCCCACTGTCAATGGGATTTAAGTTGCCAGTTTATATGTGATTTCATGGAACACAACCAAGTTCTACTTAATACCTTTATGCAA

TTTTTTTTTCACTGATGAAAAATCAATATCCACATCAATGGGTGCCCAGCTGCGGATCACCTCTCCTAAAAAGCGATCTTGTCAGTATTGAAGAAATGTA

GAACCATAATTTTCACTACTAATATCATTTTGCTCAACTACTTCTGTATATTGTGGAAAAAGGGGTGGGGCCGGGGGAATGTGTGTTTCCACATTTTCTG

AGAGGTGAAAATATTTTTGTGTTGCTTTGTCCTAATGGGTACTTCAAATGAAACACCATACAATTTTAAATGACATGCAATTAACGAATATTTTTTACTC

TCATAACATTAAAAGCATTTGTTGTG
Translation
 MISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKA

MSTDEGTYVCIAENRVGKVEASATLTVRV VRPVA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTG

DLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGT

LQIKNLR ISDTGTYTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNS

WQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQF

IQGYRVMYRQTSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDP

PPADHQNGIIQEYK IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQP

AFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DV

LPPVPGQGDKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNG GGKGGK

KKKTKNSSKAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQST

ATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNL

DSSVTG - UNI15643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDD - UNI15643 - DLPPPPD

PPPGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQDWINSTERQEETRKAPHKQGVGSE - UNI15643 - E

ESLVPYSKPSFPSPGGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTE - UNI14030 - E
Transcript ENSMUST00000114264
Sequence
TCAGTATTGCGAGATGACTTCCGGCAAAACCCCACAGATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAG

AACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGA

AAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTC

TCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGA

TGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTAT

TGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCCTCACTGTCCGAG TTCGCCCTGTTG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATC

AGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTAC

TTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTA

CATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCA

AGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGC

TTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGT

GTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTC

CCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGT

ATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCA

ACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCC

CAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGT

CACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCT

AGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAA

GGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGC

ACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTC

CATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTG

CAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCA

CGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAA

GAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATC

CCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG 

ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTA

CAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCA

CAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACG CCTTACTTTACATCCCT

GACTACCGATTGGCTGAGGGATTGTCTAATAGAATGCCACACAACCAGTCACAGGATTTCAGCACCACCAGCTCTCACAACAGCTCAGAAAGGAGTGGCA

GTCTCTCAG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTC

CTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGCTGGTGCCCACCATTACCGG

TGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTAT

CTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGACAAGGGCCTAT

CAGTTTGATATAGCAAAACAAACATG GCACATTCAAAGCAATACCCCACCTCCACAACCCCCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATT

TCTGATTTGGAGACAGATGTTCCAGATGAGGATGCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGAT

CCAGTATGGACAATCTAGACAGCTCTGTCACAG - UNI15643 - GAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCACCAGCCCATTTTCTACG

GACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCACGAAAAAACATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATC

GGAGGGAAGGGATGCCAGATG - UNI15643 - ATCTTCCCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAA

CACTCTGGTAACGTGGAAAACTCAACAGAGAGAAAAGGAAGCTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGACACAAAGAGCTCATTGGATTGTC

CAGCTAAAACTGTTCTAGAGTGGCAGCGTCAAACCCAGGACTGGATAAACTCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGT

TGGATCAG - UNI15643 - AGGAGTCCCTGGTGCCCTACAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTA

AAGGGTCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAATGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCA

AGGACAGTTTACAG - UNI14030 - AGTAACTGAGAGGGGACATACAAAGATGCTCTGAGGACCATCAGGTCCAAACTCATGGAAGTGATAACATTT

AACAGTGCAATGAACAATTTCTTTATTTATGTACTATTAAAAAAAAACTGTAAATGCAATGTAAAGACACACAGCCACACATATTCCACAGTTATTTTCT

TGTGTTCTTCTCTTACTTACACCACCCACCTTAACTCTTTCTTGTCAGGAGTATATAAGAAAAAGAAAGAAAGCAAAACTCACCCTCCAGGAAGAAAAGG

ATTTTTCCTCTGTATATAATTTCTTTTGTGCATTGCTATGCAAGCTCACTCTTTTTAACTCTGTTCATATTATTGTCTGTTCTGATTGGTCTGTTGTACT

ATATGTGAATTAATGGGCTGTGGTGCCATATATTAACTTTTAATTGTGTAACTTTTTATGTTTAAATTTTGCACTGCGATTTTATTTGGTGATAAGCACA

AATCTCTACTCCTCATGACATGAAGAAAAGATTGAATGTGAAGGGAGTTTTCTGTACTGTAAGTTAGGTTGGATAATGCTGGTGTAACCAATCCAGTTAG

ATGGTTTTCAGTTGGGGGTGTAGAAATAGGAAGATCGAAGGAATGATGGTGTTGGCAAAGTCTTCTTGAAACAACAGATATTGAGACAATTTTAAGAAGC

AGAAAGATGGATACTATTGACTAAAGCAGGGGTCAAAAGAAGGGGGTTTAAGTCTAGACAGAGTATGTAATAAAGTATGGTGGTAGCAAAGATGTACTAA

CTTGCTTTAAAAATATTATTAAAGTTTTATTTAGAATGAACTTTACCTGCCATTGTAATTAACCCATCTTAGAATTACAATGAGCAAAATAAAAATCAAG

GTGTTTCAAGAGATCTGTATTTATATTACAGCTTTTTAAAAACAGCAGTTTTGAATAATCATAATTAATCTCTCCAACTCATTAAGTCAGACTATAACAT

GGAGTTCCCCAAGGAAACAAACAAAAAAAATGAACTCCAGAAACTCTAGCAAATAGTTAAAGAAGCAACTTATTCTTCGAGCATACTCGGCTACTCTTGA

ATATGAGCTCAATTGCAATATCTTGTTCATCTTTCTAATACATGTACAGTACATATTAGAGGATGTAGGCACATCACTTAAGTTCATTTCTTTTTAAAAA

AAAAAAGCAAACTAATGCATTCTGCATACAATTTTGTGTTTCTTTTGGTTAAAATGTGAAATCGATGCCACCAGATGTATAGCCACATTATAAGTGCTTA

AAGGCAGTGCTCACAGTATGTTCAGTTTCCAGTTAGTAGATTTATTGGACTCAATATTTTCTGGTACATTCTCAGAAATTGGCTACCAACTCAAATCTGT

TTGACCCATTTTGAATGAGTAAATCGGAAAGAACAGTCAAAAGGGAGAAAAAAATGCATGTTTATACACTTTTTAAATAAAACCAAATCTTGTAAGTGGA

CATTAATAACAGTGTCCTGCCTCATTTGTTTTCACGACTCTGAGAACAAGGAGTTGCTCAACATCCATTATGTATGCTCAAGATAAATGTGACTTTGAAA

TGTATGTTAGCTACTGTACATGTATGTAAGTCAAGTAGATGATAGCCTTCCTGAAACTACCACTAATAATATTTTCCCATGTGCTACTTACACAAGCTTA

AATTCTAGTTCAGCAAATGTTTTTCATTATTTTTTCTTACGGTTTATTCAATAGAGGGTACCTAGAAAAATATTCAGTGTGATGGTCAACATATTGAGTG

TTCAAGTAGGGGATATTTACTTTGGCAATACATACTGTGCATTATTGGTTCAGATGCCAATTCATGAGACATTATCATAGGAAATGGATAATATAAGAAC

ATGGCTCTAAGGGTCCTTCTCCACAGGCAAGCATAGAATTTGAGGTTCTTCATGGGTCCCAAAACTTGCTTAGTGTTATATACTTAACTTCCTTCACTGA

AGTATCAAGCAATTCTAACACACCGTTTAACAACTTTCTACCATCAGTGCCTGCATTTTATTGAAGTTTGATGTCTCTGGTACAAGGAAATAGAGAAAGC

TGAACAGTTTCTGTTGGGAGAAAAAGTTTCTGTAATTATTGTCAATTCTAAGTTGTGATGAATATAACTTTTCATCTATACAGTTCCTTACTCATGGTCT

CTATTTAAAAGCATAGGATCTTTTAAGATATACTTTTAGCTGAGTCTTCACTGTATGTTCATGAATAATATAATTTAGTGAAAAACTTTAGTACATCATA

TGTATGGTAACTGACATTTGCAGATTATTATCAAACCAAATCATAAGAAATAATATCTTCAGATCACATGATGGCTTACCGAACAATTTCAGGTTATAGC

ATGATGTCTTTCTGATTGTCTTCAGTATATGATCATAAGCAATTATATTGTGTCCATACAGTTTACATACTGTGATTCCCGCAAAATCTTGCATCTGATA

TCTACCATGAAGATGAAATAATATGCTATGAATTTCAGGCATAGACATACTATCAGCAATAGAAAGCCTTCATCATCTAGATATCTGGATAAATCCATTC

ATCGTCAACCATCAGATTGTTAACTGGGGAACACGTACCTCCCTCACAAATGCTTTCTTTTCGTCTTGTAGTTGATTGAATGTGATAGGAAATCTGCTGA

GTTGACTCTTCTGTGGGCCTGAGCAGAAACATGCATAAGCCATCAGAAGGAAGTCTGGATGGGAAGGAAACCTTGTCTTTCACTCGTAGGCAATACTGCT

GTGTAGTCACGGCAGACCCAAGCACAGCTTCTTTCAGAACATGCAAAGTCTCCTTATGAAATATACACATCAGTGCCCAAACTCAGGTGTACCAGTGTAA

AGCGTAGGGTTTGCCTACCCTTTTTTCATATCATTTTACATAAGCAAGTTAGGAGACTACAGGGCTATGAAAATAAATGTTTCCTTAACAGGATTTGGAG

CAAGTTCACGGGAGTACATAGGACAGTCGAGCCCAGTGTAAACACTACCAAAGGAAAGGACAGCCTTGCAGAAGCGTGAGCTCCGACTAACAGAGCGGCT

TAAGTATGCTCTGTGATACAGCTTAATGCACTCCCTATTCAAATCCCACTGTCAATGGGATTTAAGTTGCCAGTTTATATGTGATTTCATGGAACACAAC

CAAGTTCTACTTAATACCTTTATGCAATTTTTTTTTCACTGATGAAAAATCAATATCCACATCAATGGGTGCCCAGCTGCGGATCACCTCTCCTAAAAAG

CGATCTTGTCAGTATTGAAGAAATGTAGAACCATAATTTTCACTACTAATATCATTTTGCTCAACTACTTCTGTATATTGTGGAAAAAGGGGTGGGGCCG

GGGGAATGTGTGTTTCCACATTTTCTGAGAGGTGAAAATATTTTTGTGTTGCTTTGTCCTAATGGGTACTTCAAATGAAACACCATACAATTTTAAATGA

CATGCAATTAACGAATATTTTTTACTCTCATAACATTAAAAGCATTTGTTGTG
Translation
 MISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKA

MSTDEGTYVCIAENRVGKVEASATLTVRV VRPVA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTG

DLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGT

LQIKNLR ISDTGTYTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNS

WQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQF

IQGYRVMYRQTSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDP

PPADHQNGIIQEYK IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQP

AFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DV

LPPVPGQGDKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNA ALLYIP

DYRLAEGLSNRMPHNQSQDFSTTSSHNSSERSGSLSG GGKGGKKKKTKNSSKAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCP

PLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYV

SGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTG - UNI15643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTK

KHKGGRMDPQPVLPHRREGMPDD - UNI15643 - DLPPPPDPPPGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEW

QRQTQDWINSTERQEETRKAPHKQGVGSE - UNI15643 - EESLVPYSKPSFPSPGGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGS

NSQGQFTE - UNI14030 - E
Transcript ENSMUST00000114266
Sequence
TTCTTCAGTATTGCGAGATGACTTCCGGCAAAACCCCACAGATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACAC

CCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCGAATTGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACT

AGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAATATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACA

TTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGAAGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAA

AAGATGATGCAGACTTGCCGAGAGGAAG GTATGATATCAAAGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGT

GTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCTACCCTCACTGTCCGAG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTG

CTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGAAACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGA

ATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCCACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCA

GGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGTTGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAAT

AAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGTGTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTT

CTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAACACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACA

AGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGTAACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCA

CCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGTCACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTG

AGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGTGGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCT

ACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGTGATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAG

GAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTCGTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGAC

G GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTGATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAA

AGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAAAGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGAC

AGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAAGTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATC

AGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGGAATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAAT

AAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGGCTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTG

GAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACGTAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCG

TGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGCTGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGG

ACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGAGGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACC

CATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTGAACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGC

CTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTCTCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTC

CAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAATCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAA

AGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTATTCGCTACCTGATCAGAACAAGGGGAACAACG CCTTACTTTACATCCCTGACTACCGA

TTGGCTGAGGGATTGTCTAATAGAATGCCACACAACCAGTCACAGGATTTCAGCACCACCAGCTCTCACAACAGCTCAGAAAGGAGTGGCAGTCTCTCAG

 GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTCGAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCG

TCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCGGAACAAGAAAATGG CTATGACAGTGACAGCTGGTGCCCACCATTACCGGTGCAAACAT

ACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAAGATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGG

ACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAGAGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGACAAGGGCCTATCAGTTTGAT

ATAGCAAAACAAACATG GCACATTCAAAGCAATACCCCACCTCCACAACCCCCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTG

GAGACAGATGTTCCAGATGAGGATGCTGATGATGAAGAGGAACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGATCCAGTATGG

ACAATCTAGACAGCTCTGTCACAG - UNI15643 - GAAAAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCACCAGCCCATTTTCTACGGACAGTAAC

ACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCACGAAAAAACATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATCGGAGGGAAG

GGATGCCAGATG - UNI15643 - ATCTTCCCCCACCACCAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAACACTCTGGT

AACGTGGAAAACTCAACAGAGAGAAAAGGAAGCTCTCTAGAGAGACAACAAGCAGCCAACTTAGAAGACACAAAGAGCTCATTGGATTGTCCAGCTAAAA

CTGTTCTAGAGTGGCAGCGTCAAACCCAGGACTGGATAAACTCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGTTGGATCAG 

- UNI15643 - AGGAGTCCCTGGTGCCCTACAGCAAGCCCAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAAGGGTCCA

CTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAGAGGAATGCCAATGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCAAGGACAGTT

TACAG - UNI14030 - AGTAACTGAGAGGGGACATACAAAGATGCTCTGAGGACCATCAGGTCCAAACTCATGGAAGTGATAACATTTAACAGTGCA

ATGAACAATTTCTTTATTTATGTACTATTAAAAAAAAACTGTAAATGCAATGTAAAGACACACAGCCACACATATTCCACAGTTATTTTCTTGTGTTCTT

CTCTTACTTACACCACCCACCTTAACTCTTTCTTGTCAGGAGTATATAAGAAAAAGAAAGAAAGCAAAACTCACCCTCCAGGAAGAAAAGGATTTTTCCT

CTGTATATAATTTCTTTTGTGCATTGCTATGCAAGCTCACTCTTTTTAACTCTGTTCATATTATTGTCTGTTCTGATTGGTCTGTTGTACTATATGTGAA

TTAATGGGCTGTGGTGCCATATATTAACTTTTAATTGTGTAACTTTTTATGTTTAAATTTTGCACTGCGATTTTATTTGGTGATAAGCACAAATCTCTAC

TCCTCATGACATGAAGAAAAGATTGAATGTGAAGGGAGTTTTCTGTACTGTAAGTTAGGTTGGATAATGCTGGTGTAACCAATCCAGTTAGATGGTTTTC

AGTTGGGGGTGTAGAAATAGGAAGATCGAAGGAATGATGGTGTTGGCAAAGTCTTCTTGAAACAACAGATATTGAGACAATTTTAAGAAGCAGAAAGATG

GATACTATTGACTAAAGCAGGGGTCAAAAGAAGGGGGTTTAAGTCTAGACAGAGTATGTAATAAAGTATGGTGGTAGCAAAGATGTACTAACTTGCTTTA

AAAATATTATTAAAGTTTTATTTAGAATGAACTTTACCTGCCATTGTAATTAACCCATCTTAGAATTACAATGAGCAAAATAAAAATCAAGGTGTTTCAA

GAGATCTGTATTTATATTACAGCTTTTTAAAAACAGCAGTTTTGAATAATCATAATTAATCTCTCCAACTCATTAAGTCAGACTATAACATGGAGTTCCC

CAAGGAAACAAACAAAAAAAATGAACTCCAGAAACTCTAGCAAATAGTTAAAGAAGCAACTTATTCTTCGAGCATACTCGGCTACTCTTGAATATGAGCT

CAATTGCAATATCTTGTTCATCTTTCTAATACATGTACAGTACATATTAGAGGATGTAGGCACATCACTTAAGTTCATTTCTTTTTAAAAAAAAAAAGCA

AACTAATGCATTCTGCATACAATTTTGTGTTTCTTTTGGTTAAAATGTGAAATCGATGCCACCAGATGTATAGCCACATTATAAGTGCTTAAAGGCAGTG

CTCACAGTATGTTCAGTTTCCAGTTAGTAGATTTATTGGACTCAATATTTTCTGGTACATTCTCAGAAATTGGCTACCAACTCAAATCTGTTTGACCCAT

TTTGAATGAGTAAATCGGAAAGAACAGTCAAAAGGGAGAAAAAAATGCATGTTTATACACTTTTTAAATAAAACCAAATCTTGTAAGTGGACATTAATAA

CAGTGTCCTGCCTCATTTGTTTTCACGACTCTGAGAACAAGGAGTTGCTCAACATCCATTATGTATGCTCAAGATAAATGTGACTTTGAAATGTATGTTA

GCTACTGTACATGTATGTAAGTCAAGTAGATGATAGCCTTCCTGAAACTACCACTAATAATATTTTCCCATGTGCTACTTACACAAGCTTAAATTCTAGT

TCAGCAAATGTTTTTCATTATTTTTTCTTACGGTTTATTCAATAGAGGGTACCTAGAAAAATATTCAGTGTGATGGTCAACATATTGAGTGTTCAAGTAG

GGGATATTTACTTTGGCAATACATACTGTGCATTATTGGTTCAGATGCCAATTCATGAGACATTATCATAGGAAATGGATAATATAAGAACATGGCTCTA

AGGGTCCTTCTCCACAGGCAAGCATAGAATTTGAGGTTCTTCATGGGTCCCAAAACTTGCTTAGTGTTATATACTTAACTTCCTTCACTGAAGTATCAAG

CAATTCTAACACACCGTTTAACAACTTTCTACCATCAGTGCCTGCATTTTATTGAAGTTTGATGTCTCTGGTACAAGGAAATAGAGAAAGCTGAACAGTT

TCTGTTGGGAGAAAAAGTTTCTGTAATTATTGTCAATTCTAAGTTGTGATGAATATAACTTTTCATCTATACAGTTCCTTACTCATGGTCTCTATTTAAA

AGCATAGGATCTTTTAAGATATACTTTTAGCTGAGTCTTCACTGTATGTTCATGAATAATATAATTTAGTGAAAAACTTTAGTACATCATATGTATGGTA

ACTGACATTTGCAGATTATTATCAAACCAAATCATAAGAAATAATATCTTCAGATCACATGATGGCTTACCGAACAATTTCAGGTTATAGCATGATGTCT

TTCTGATTGTCTTCAGTATATGATCATAAGCAATTATATTGTGTCCATACAGTTTACATACTGTGATTCCCGCAAAATCTTGCATCTGATATCTACCATG

AAGATGAAATAATATGCTATGAATTTCAGGCATAGACATACTATCAGCAATAGAAAGCCTTCATCATCTAGATATCTGGATAAATCCATTCATCGTCAAC

CATCAGATTGTTAACTGGGGAACACGTACCTCCCTCACAAATGCTTTCTTTTCGTCTTGTAGTTGATTGAATGTGATAGGAAATCTGCTGAGTTGACTCT

TCTGTGGGCCTGAGCAGAAACATGCATAAGCCATCAGAAGGAAGTCTGGATGGGAAGGAAACCTTGTCTTTCACTCGTAGGCAATACTGCTGTGTAGTCA

CGGCAGACCCAAGCACAGCTTCTTTCAGAACATGCAAAGTCTCCTTATGAAATATACACATCAGTGCCCAAACTCAGGTGTACCAGTGTAAAGCGTAGGG

TTTGCCTACCCTTTTTTCATATCATTTTACATAAGCAAGTTAGGAGACTACAGGGCTATGAAAATAAATGTTTCCTTAACAGGATTTGGAGCAAGTTCAC

GGGAGTACATAGGACAGTCGAGCCCAGTGTAAACACTACCAAAGGAAAGGACAGCCTTGCAGAAGCGTGAGCTCCGACTAACAGAGCGGCTTAAGTATGC

TCTGTGATACAGCTTAATGCACTCCCTATTCAAATCCCACTGTCAATGGGATTTAAGTTGCCAGTTTATATGTGATTTCATGGAACACAACCAAGTTCTA

CTTAATACCTTTATGCAATTTTTTTTTCACTGATGAAAAATCAATATCCACATCAATGGGTGCCCAGCTGCGGATCACCTCTCCTAAAAAGCGATCTTGT

CAGTATTGAAGAAATGTAGAACCATAATTTTCACTACTAATATCATTTTGCTCAACTACTTCTGTATATTGTGGAAAAAGGGGTGGGGCCGGGGGAATGT

GTGTTTCCACATTTTCTGAGAGGTGAAAATATTTTTGTGTTGCTTTGTCCTAATGGGTACTTCAAATGAAACACCATACAATTTTAAATGACATGCAATT

AACGAATATTTTTTACTCTCATAACATTAAAAGCATTTGTTGTG
Translation
SSVLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFE ER

PTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTYVCIAENRVGKVEASATLTVRA APPQFVVRP

RDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDV VLTDRPP

PIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR ISDTGTYTCVATSSSGETSWSAVLDVTE ESGATISK

NYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDP

VRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMYRQTSGLQASTVWQNLDAKVPTERSAVLVNLKKGVTYE

IKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYK IWCLGNETRFHINKTVDAAIRSVVIGGLFP

GIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAV VTFQRGDG

GLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYA

TTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNA ALLYIPDYRLAEGLSNRMPHNQSQDFSTTSSHNSSERSGSLSG GGKGGKK

KKTKNSSKAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMEDELEEDEDRVPTPPVRGVASSPAISFGQQSTA

TLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPDEDADDEEEPLEIPRPLRALDQTPGSSMDNLD

SSVTG - UNI15643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLPHRREGMPDD - UNI15643 - DLPPPPDP

PPGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQDWINSTERQEETRKAPHKQGVGSE - UNI15643 - EE

SLVPYSKPSFPSPGGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTE - UNI14030 - E
Transcript ENSMUST00000117785
Sequence
TTTTGATACTTATTTTTGTACTTCTGCTCTCTGGGATTGGTTTCTTAAACAACCTGGATCCTTTTTCATATGTCAAAATGAATCCTCTGATGTTTACACT

ATTATTGCTCTTTGGATTTCTCTGCATTCAGATTGATG GATCTCGTCTTCGTCAAGAAGACTTTCCCCCCAGGATCGTAGAACACCCTTCTGATGTCAT

CGTCTCCAAGGGAGAGCCCACCACTCTGAACTGTAAAGCAGAGGGCCGACCCACCCCCACCATTGAATGGTACAAGGATGGTGAGAGGGTGGAGACAGAC

AAGGATGATCCCAGGTCCCACAGAATGCTTCTGCCCAGCGGATCTTTATTCTTTTTGCGAATTGTTCATGGGCGCAGAAGTAAACCGGACGAAGGGAGTT

ACGTTTGTGTTGCAAGGAACTATCTTGGTGAAGCAGTGAGTCGAAATGCATCTCTGGAAGTGGCAT TATTGCGAGATGACTTCCGGCAAAACCCCACAG

ATGTGGTAGTCGCAGCTGGAGAGCCTGCAATCTTGGAGTGCCAGCCACCACGGGGACACCCAGAACCAACCATCTACTGGAAAAAGGACAAAGTCCGAAT

TGATGACAAGGAAGAGAGAATAAGT ATCCGTGGTGGGAAGCTGATGATCTCTAATACTAGGAAAAGCGATGCTGGCATGTACACCTGTGTGGGAACCAA

TATGGTGGGAGAAAGGGACAGCGACCCTGCAGAGCTCACTGTCTTTG AACGACCCACATTTCTCAGGAGGCCAATTAACCAGGTGGTGCTAGAGGAAGA

AGCTGTAGAATTCCGTTGTCAGGTCCAAGGAGATCCCCAGCCAACGGTGAGGTGGAAAAAAGATGATGCAGACTTGCCGAGAGGAAG GTATGATATCAA

AGATGACTACACGCTGAGAATTAAAAAGGCCATGAGTACTGATGAAGGTACCTATGTGTGTATTGCTGAGAATCGGGTGGGAAAAGTGGAAGCCTCTGCT

ACCCTCACTGTCCGAG CTCCTCCACAGTTTGTGGTTAGGCCAAGAGATCAGATCGTTGCTCAAGGCCGAACAGTGACATTCCCCTGTGAAACTAAAGGA

AACCCACAGCCAGCTGTTTTTTGGCAGAAAGAAGGCAGCCAG AACCTACTTTTCCCGAATCAACCTCAGCAGCCCAACAGCCGATGTTCAGTGTCGCCC

ACGGGGGACCTCACCATCACCAACATCCAGCGTTCAGATGCGGGTTACTACATCTGCCAGGCCCTAACCGTGGCAGGAAGCATTTTAGCTAAAGCACAGT

TGGAAGTTACTGACG TTTTGACAGATAGACCTCCACCCATAATCTTGCAAGGACCAATAAACCAAACACTTGCAGTAGACGGTACAGCATTGTTGAAGT

GTAAAGCCACTGGTGAGCCTCTGCCTGTAATTAGCTGGCTAAAGGAGGGCTTTACTTTTCTGGGGAGAGATCCAAGAGCCACGATCCAAGACCAAGGAAC

ACTGCAGATTAAGAATTTACGG ATATCTGATACTGGCACTTATACTTGTGTGGCTACAAGTTCCAGTGGAGAGACTTCCTGGAGTGCAGTGCTGGATGT

AACAG AATCTGGAGCAACAATCAGTAAAAATTATGATATGAATGACCTCCCGGGACCACCATCCAAACCTCAGGTCACTGATGTTTCTAAGAACAGTGT

CACCTTATCCTGGCAGCCAGGTACACCTGGCGTTCTTCCTGCAAGCGCGTATATCATTGAGGCTTTCAG CCAATCGGTGAGCAATAGCTGGCAGACAGT

GGCAAACCATGTTAAGACAACTCTGTATACAGTAAGGGGGCTGAGGCCCAACACAATCTACTTGTTTATGGTCAGAGCGATCAACCCACAAGGTCTCAGT

GATCCAAGTCCTATGTCGGATCCTGTACGCACACAAG ATATCAGCCCCCCAGCACAAGGAGTGGACCACAGACAGGTGCAGAAGGAATTAGGTGATGTC

GTTGTTCGTCTCCATAATCCAGTTGTCCTGACACCTACAACTGTTCAAGTCACATGGACG GTGGACCGACAACCCCAGTTTATTCAGGGCTACAGAGTG

ATGTACCGTCAGACTTCGGGACTACAAGCCTCAACTGTGTGGCAGAATCTAGACGCCAAAGTCCCGACTGAGAGGAGTGCTGTCCTTGTGAATTTGAAAA

AGGGGGTGACTTATGAAATTAAAGTCCGGCCGTATTTTAACGAGTTCCAAGGAATGGACAGTGAATCGAAAACAGTCCGAACCACTGAGGAAG CCCCAA

GTGCCCCTCCCCAGTCTGTCACTGTGCTGACAGTTGGAAGTCACAACAGCACAAGCATCAGTGTTTCCTGGGATCCTCCACCAGCCGACCACCAGAATGG

AATTATTCAGGAATATAAG ATCTGGTGTCTGGGAAACGAAACGCGATTCCATATCAATAAAACGGTGGATGCAGCCATTCGCTCTGTAGTAATAGGTGG

CTTGTTCCCTGGAATTCAGTACCGGGTAGAAGTGGCAGCTAGCACAAGTGCAGGGGTTGGAGTAAAAAGTGAACCACAGCCGATAATAATTG GGGGACG

TAACGAAGTTGTCATTACTGAAAACAATAACAGCATCACTGAGCAAATCACGGATGTCGTGAAGCAACCGGCATTTATAGCTGGCATTGGTGGTGCCTGC

TGGGTAATTCTGATGGGTTTTAGCATCTGGTTGTACTGGAGAAGAAAGAAGAGAAAGGGACTCAGCAATTATGCTG TAACATTTCAAAGAGGAGATGGA

GGACTAATGAGCAATGGGAG CCGTCCAGGTCTTCTAAATGCTGGCGATCCCAATTACCCATGGCTTGCTGATTCTTGGCCAGCCACGAGTTTGCCAGTG

AACAATAGCAATAGTGGCCCAAATGAAATTGGAAATTTTGGGCGTGGAG ATGTGCTGCCTCCGGTGCCAGGCCAAGGGGATAAAACAGCGACCATGCTC

TCGGATGGAGCCATTTATAGCAGCATTGACTTCACTACCAAAACCACTTACAACAGTTCCAGCCAAATAACACAGGCCACCCCATATGCCACTACACAAA

TCCTGCATTCAAACAGCATCCACGAACTGGCAGTTGATCTTCCTGATCCACAGTGGAAAAGCTCAGTTCAACAGAAGACAGACCTCATGGGATTTGGTTA

TTCGCTACCTGATCAGAACAAGGGGAACAACG CCTTACTTTACATCCCTGACTACCGATTGGCTGAGGGATTGTCTAATAGAATGCCACACAACCAGTC

ACAGGATTTCAGCACCACCAGCTCTCACAACAGCTCAGAAAGGAGTGGCAGTCTCTCAG GTGGGAAAGGTGGAAAAAAGAAGAAAACTAAAAATTCTTC

GAAAGCGCAGAAAAACAACGGATCCACTTGGGCTAATGTCCCTCTACCTCCTCCTCCCGTCCAGCCCCTTCCTGGTACAGAGCTGGGCCACTATGCTGCG

GAACAAGAAAATGG CTATGACAGTGACAGCTGGTGCCCACCATTACCGGTGCAAACATACTTGCATCAGGGTATGGAAGATGAGCTGGAAGAAGACGAA

GATCGGGTCCCAACACCTCCTGTTCGCGGCGTGGCCTCTTCACCAGCTATCTCTTTTGGACAGCAGTCCACTGCCACTCTTACTCCATCCCCACGGGAAG

AGATGCAACCCATGCTGCAAGCTCACTTGGATGAGTTGACAAGGGCCTATCAGTTTGATATAGCAAAACAAACATG GCACATTCAAAGCAATACCCCAC

CTCCACAACCCCCAGCTCCGCCATTAGGTTACGTGTCCGGAGCCTTGATTTCTGATTTGGAGACAGATGTTCCAGATGAGGATGCTGATGATGAAGAGGA

ACCATTAGAAATTCCCAGGCCCCTCAGAGCACTAGACCAGACACCTGGATCCAGTATGGACAATCTAGACAGCTCTGTCACAG - UNI15643 - GAA

AAGCCTTTAGCTCCTCTCAAAGGCAGCGGCCCACCAGCCCATTTTCTACGGACAGTAACACCAGTGCTGCCCAGAATCAAAGCCAGAGGCCTCGGCCCAC

GAAAAAACATAAGGGAGGACGGATGGACCCACAGCCAGTGTTACCTCATCGGAGGGAAGGGATGCCAGATG - UNI15643 - ATCTTCCCCCACCAC

CAGATCCCCCACCAGGTCAGGGTTTAAGGCAGCAGATAGGCCTGAGCCAACACTCTGGTAACGTGGAAAACTCAACAGAGAGAAAAGGAAGCTCTCTAGA

GAGACAACAAGCAGCCAACTTAGAAGACACAAAGAGCTCATTGGATTGTCCAGCTAAAACTGTTCTAGAGTGGCAGCGTCAAACCCAGGACTGGATAAAC

TCTACAGAACGCCAAGAAGAAACTCGGAAAGCCCCACACAAACAAGGGGTTGGATCAG - UNI15643 - AGGAGTCCCTGGTGCCCTACAGCAAGCC

CAGCTTCCCGTCTCCTGGCGGGCACAGCTCATCAGGAACATCTTCCTCTAAAGGGTCCACTGGCCCTCGGAAGGCTGACGTGCTGAGAGGCAGCCACCAG

AGGAATGCCAATGACCTTCTCGACATTGGATATGTGGGCTCAAATAGTCAAGGACAGTTTACAG - UNI14030 - AGTAACTGAGAGGGGACATACA

AAGATGCTCTGAGGACCATCAGGTCCAAACTCATGGAAGTGATAACATTTAACAGTGCAATGAACAATTTCTTTATTTATGTACTATTAAAAAAAAACTG

TAAATGCAATGTAAAGACACACAGCCACACATATTCCACAGTTATTTTCTTGTGTTCTTCTCTTACTTACACCACCCACCTTAACTCTTTCTTGTCAGGA

GTATATAAGAAAAAGAAAGAAAGCAAAACTCACCCTCCAGGAAGAAAAGGATTTTTCCTCTGTATATAATTTCTTTTGTGCATTGCTATGCAAGCTCACT

CTTTTTAACTCTGTTCATATTATTGTCTGTTCTGATTGGTCTGTTGTACTATATGTGAATTAATGGGCTGTGGTGCCATATATTAACTTTTAATTGTGTA

ACTTTTTATGTTTAAATTTTGCACTGCGATTTTATTTGGTGATAAGCACAAATCTCTACTCCTCATGACATGAAGAAAAGATTGAATGTGAAGGGAGTTT

TCTGTACTGTAAGTTAGGTTGGATAATGCTGGTGTAACCAATCCAGTTAGATGGTTTTCAGTTGGGGGTGTAGAAATAGGAAGATCGAAGGAATGATGGT

GTTGGCAAAGTCTTCTTGAAACAACAGATATTGAGACAATTTTAAGAAGCAGAAAGATGGATACTATTGACTAAAGCAGGGGTCAAAAGAAGGGGGTTTA

AGTCTAGACAGAGTATGTAATAAAGTATGGTGGTAGCAAAGATGTACTAACTTGCTTTAAAAATATTATTAAAGTTTTATTTAGAATGAACTTTACCTGC

CATTGTAATTAACCCATCTTAGAATTACAATGAGCAAAATAAAAATCAAGGTGTTTCAAGAGATCTGTATTTATATTACAGCTTTTTAAAAACAGCAGTT

TTGAATAATCATAATTAATCTCTCCAACTCATTAAGTCAGACTATAACATGGAGTTCCCCAAGGAAACAAACAAAAAAAATGAACTCCAGAAACTCTAGC

AAATAGTTAAAGAAGCAACTTATTCTTCGAGCATACTCGGCTACTCTTGAATATGAGCTCAATTGCAATATCTTGTTCATCTTTCTAATACATGTACAGT

ACATATTAGAGGATGTAGGCACATCACTTAAGTTCATTTCTTTTTAAAAAAAAAAAGCAAACTAATGCATTCTGCATACAATTTTGTGTTTCTTTTGGTT

AAAATGTGAAATCGATGCCACCAGATGTATAGCCACATTATAAGTGCTTAAAGGCAGTGCTCACAGTATGTTCAGTTTCCAGTTAGTAGATTTATTGGAC

TCAATATTTTCTGGTACATTCTCAGAAATTGGCTACCAACTCAAATCTGTTTGACCCATTTTGAATGAGTAAATCGGAAAGAACAGTCAAAAGGGAGAAA

AAAATGCATGTTTATACACTTTTTAAATAAAACCAAATCTTGTAAGTGGACATTAATAACAGTGTCCTGCCTCATTTGTTTTCACGACTCTGAGAACAAG

GAGTTGCTCAACATCCATTATGTATGCTCAAGATAAATGTGACTTTGAAATGTATGTTAGCTACTGTACATGTATGTAAGTCAAGTAGATGATAGCCTTC

CTGAAACTACCACTAATAATATTTTCCCATGTGCTACTTACACAAGCTTAAATTCTAGTTCAGCAAATGTTTTTCATTATTTTTTCTTACGGTTTATTCA

ATAGAGGGTACCTAGAAAAATATTCAGTGTGATGGTCAACATATTGAGTGTTCAAGTAGGGGATATTTACTTTGGCAATACATACTGTGCATTATTGGTT

CAGATGCCAATTCATGAGACATTATCATAGGAAATGGATAATATAAGAACATGGCTCTAAGGGTCCTTCTCCACAGGCAAGCATAGAATTTGAGGTTCTT

CATGGGTCCCAAAACTTGCTTAGTGTTATATACTTAACTTCCTTCACTGAAGTATCAAGCAATTCTAACACACCGTTTAACAACTTTCTACCATCAGTGC

CTGCATTTTATTGAAGTTTGATGTCTCTGGTACAAGGAAATAGAGAAAGCTGAACAGTTTCTGTTGGGAGAAAAAGTTTCTGTAATTATTGTCAATTCTA

AGTTGTGATGAATATAACTTTTCATCTATACAGTTCCTTACTCATGGTCTCTATTTAAAAGCATAGGATCTTTTAAGATATACTTTTAGCTGAGTCTTCA

CTGTATGTTCATGAATAATATAATTTAGTGAAAAACTTTAGTACATCATATGTATGGTAACTGACATTTGCAGATTATTATCAAACCAAATCATAAGAAA

TAATATCTTCAGATCACATGATGGCTTACCGAACAATTTCAGGTTATAGCATGATGTCTTTCTGATTGTCTTCAGTATATGATCATAAGCAATTATATTG

TGTCCATACAGTTTACATACTGTGATTCCCGCAAAATCTTGCATCTGATATCTACCATGAAGATGAAATAATATGCTATGAATTTCAGGCATAGACATAC

TATCAGCAATAGAAAGCCTTCATCATCTAGATATCTGGATAAATCCATTCATCGTCAACCATCAGATTGTTAACTGGGGAACACGTACCTCCCTCACAAA

TGCTTTCTTTTCGTCTTGTAGTTGATTGAATGTGATAGGAAATCTGCTGAGTTGACTCTTCTGTGGGCCTGAGCAGAAACATGCATAAGCCATCAGAAGG

AAGTCTGGATGGGAAGGAAACCTTGTCTTTCACTCGTAGGCAATACTGCTGTGTAGTCACGGCAGACCCAAGCACAGCTTCTTTCAGAACATGCAAAGTC

TCCTTATGAAATATACACATCAGTGCCCAAACTCAGGTGTACCAGTGTAAAGCGTAGGGTTTGCCTACCCTTTTTTCATATCATTTTACATAAGCAAGTT

AGGAGACTACAGGGCTATGAAAATAAATGTTTCCTTAACAGGATTTGGAGCAAGTTCACGGGAGTACATAGGACAGTCGAGCCCAGTGTAAACACTACCA

AAGGAAAGGACAGCCTTGCAGAAGCGTGAGCTCCGACTAACAGAGCGGCTTAAGTATGCTCTGTGATACAGCTTAATGCACTCCCTATTCAAATCCCACT

GTCAATGGGATTTAAGTTGCCAGTTTATATGTGATTTCATGGAACACAACCAAGTTCTACTTAATACCTTTATGCAATTTTTTTTTCACTGATGAAAAAT

CAATATCCACATCAATGGGTGCCCAGCTGCGGATCACCTCTCCTAAAAAGCGATCTTGTCAGTATTGAAGAAATGTAGAACCATAATTTTCACTACTAAT

ATCATTTTGCTCAACTACTTCTGTATATTGTGGAAAAAGGGGTGGGGCCGGGGGAATGTGTGTTTCCACATTTTCTGAGAGGTGAAAATATTTTTGTGTT

GCTTTGTCCTAATGGGTACTTCAAATGAAACACCATACAATTTTAAATGACATGCAATTAACGAATATTTTTTACTCTCATAACATTAAAAGCATTTGTT

GTG
Translation
MNPLMFTLLLLFGFLCIQIDG GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHG

RRSKPDEGSYVCVARNYLGEAVSRNASLEVAL LLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERIS IRGGKLMISNTRK

SDAGMYTCVGTNMVGERDSDPAELTVFE ERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGR RYDIKDDYTLRIKKAMSTDEGTY

VCIAENRVGKVEASATLTVRA APPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQ NLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGY

YICQALTVAGSILAKAQLEVTDV VLTDRPPPIILQGPINQTLAVDGTALLKCKATGEPLPVISWLKEGFTFLGRDPRATIQDQGTLQIKNLR ISDTGT

YTCVATSSSGETSWSAVLDVTE ESGATISKNYDMNDLPGPPSKPQVTDVSKNSVTLSWQPGTPGVLPASAYIIEAFS SQSVSNSWQTVANHVKTTLYT

VRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQD DISPPAQGVDHRQVQKELGDVVVRLHNPVVLTPTTVQVTWT VDRQPQFIQGYRVMYRQTSGL

QASTVWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEA APSAPPQSVTVLTVGSHNSTSISVSWDPPPADHQNGIIQEYK

 IWCLGNETRFHINKTVDAAIRSVVIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIG GGRNEVVITENNNSITEQITDVVKQPAFIAGIGGACWVIL

MGFSIWLYWRRKKRKGLSNYAV VTFQRGDGGLMSNGS SRPGLLNAGDPNYPWLADSWPATSLPVNNSNSGPNEIGNFGRGD DVLPPVPGQGDKTATM

LSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSVQQKTDLMGFGYSLPDQNKGNNA ALLYIPDYRLAEGLSNRMPH

NQSQDFSTTSSHNSSERSGSLSG GGKGGKKKKTKNSSKAQKNNGSTWANVPLPPPPVQPLPGTELGHYAAEQENG GYDSDSWCPPLPVQTYLHQGMED

ELEEDEDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTW WHIQSNTPPPQPPAPPLGYVSGALISDLETDVPD

EDADDEEEPLEIPRPLRALDQTPGSSMDNLDSSVTG - UNI15643 - GKAFSSSQRQRPTSPFSTDSNTSAAQNQSQRPRPTKKHKGGRMDPQPVLP

HRREGMPDD - UNI15643 - DLPPPPDPPPGQGLRQQIGLSQHSGNVENSTERKGSSLERQQAANLEDTKSSLDCPAKTVLEWQRQTQDWINSTERQ

EETRKAPHKQGVGSE - UNI15643 - EESLVPYSKPSFPSPGGHSSSGTSSSKGSTGPRKADVLRGSHQRNANDLLDIGYVGSNSQGQFTE - UNI

14030 - E

For any suggestions or comments, please send an email to unitrap@crg.es