Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052533 (Nup188)
Chromosomal location
Chr 2: 30141949 - 30199782 (+)
Description
nucleoporin 188 Gene [Source:MGI (curated);Acc:Nup188-001]
RefSeq_dna
NM_198304 
RefSeq_peptide
NP_938046.2 
UniGene
Mm.330119 
MGI
MGI:2446190 
Uniprot/SWISSPROT
Q6ZQH8 
Uniprot/SPTREMBL
O89083 A2AWI5 
Human Ortholog
ENSG00000095319 (NUP188)
Omim not available
UniTrap UNI14694
Vector Insertion
Chr 2: 30141991 - 30152167
Public Clones P135A11 (ggtc) D087G04 (ggtc) (ggtc) H011B03 (ggtc) D087E03 (ggtc)
E083B06 (ggtc) FHCRC-GT-S1-2A1 (fhcrc) IST13016F7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19466
Vector Insertion
Chr 2: 30153935 - 30154010
Public Clones not available
Private Clones OST390708 (lexicon) OST339476 (lexicon) OST334171 (lexicon) OST274614 (lexicon)
OST268419 (lexicon) OST254235 (lexicon) OST251699 (lexicon) OST231827 (lexicon)
OST218033 (lexicon) OST179263 (lexicon) OST169222 (lexicon) OST94700 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17926
Vector Insertion
Chr 2: 30156319 - 30156405
Public Clones not available
Private Clones OST433459 (lexicon) OST222269 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27074
Vector Insertion
Chr 2: 30156405 - 30156528
Public Clones not available
Private Clones OST72986 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5346
Vector Insertion
Chr 2: 30172828 - 30177401
Public Clones SYA401 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8713
Vector Insertion
Chr 2: 30178268 - 30179039
Public Clones XN245 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35332
Vector Insertion
Chr 2: 30188986 - 30191843
Public Clones IST13418C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16998
Vector Insertion
Chr 2: 30191843 - 30191922
Public Clones not available
Private Clones OST451117 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20300
Vector Insertion
Chr 2: 30192598 - 30192743
Public Clones not available
Private Clones OST367852 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2135
Vector Insertion
Chr 2: 30196268 - 30197211
Public Clones AC0533 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113626
Sequence
GCGAAGATGGCGGCTGCCGCTGGTGGGCCGTGTGTGAG - UNI14694 - GAGCAGTAGAGAACTCTGGACAATTCTACTTGGGAGGTCAGCTCTTAG

AGAATTG - UNI19466 - AATCAGATTGAGGCGGAACTGAATAAATATTGGCAGCGGTTGTTAGAAGGGCTTTCTTACTACAAACCTCCCAG - UN

I17926 - - UNI19466 - TCCAAGTTCAGCTGAAAGAGTGAAAGCTAATAAAGACGTAGCGTCACCTCTGAAGGAGCTGGGCCTAAGAGTCAGCAA

GTTCTTG - UNI17926 - - UNI27074 - GGTCTTGATGAAGAGCAGAGTGTGCAGTTACTGCAGTGTTACCTTCAGGAGGATTACAGGGGTACT

CGGGACTCACTAAAG ACAGTCCTGCAAGATGAGAGGCAGAGCCAGGCCTTAACCCTGAAG ATTGCAGATTATTATTATGAAGAAAGAACCTGCATTCT

TCGTTGTGTCTTACACCTTCTGACATATTTCCAAGATGAACGCCATCCATACAGG GCGGAATATGCTGACTGTGTTGACAAACTGGAGAAGGAACTAGT

TTTAAAGTACCGGCAGCAGTTTGAGGAGCTGTATAGAACAGAAGCACCAACCTGGGAGACGCATGGCAACCTCATG ACTGAGCGTCAGGTGTCGCGGTG

GTTGGTTCAGTGCCTCCGGGAACAGTCCATGCTGTTAGAAATTATTTTCCTTTATTATGCATACTTCGAGATGGCACCAAGTGACCTATTGGTACTAACC

AAGATGTTCAAGGAGCAAGGGTTTGGTAGTAGGCAGACCAGCAGGCACCTTGTGGGTGGAACCATGGATCCTTTTGTAGATCGCATTGG GTACTTCAGT

GCCCTCATCCTGGTGGAAGGGATGGACATCGAGTCCCTGCACAAGTACGCCTTGGATGACAGGCGAGAGCTGCACCAGTTTGCTCAGGATGGCCTCATCT

GCCAG GACATGGACCGAGCGATGTTGACCTTGGGAGACATTCCGCACCACGCCCCTGTGCTTTTAGCCTGGGCTCTCCTCCGTCACACACTGAGCCCAG

AAGAGACCAGCAGTGTGGTCAGGAAGATAGGGGGCACGGCCATCCAGCTGAATGTGTTTCAGTACTTGACTCGACTGCTTCGGTCACTTGCCAGTGGAGG

AAATGAT TGCACCACGAGCACCGCCTGCATGTGTGTCTATGGTCTTCTCTCCTTTGCCCTCACCTCACTGGAGCTGCACACACTGGGCAACCAGCAG G

ATGTCATTGACACAGCATGTGAAGTCCTGGCAGACCCTTCCCTTCCAGAGCTGTTCTGGGGAACA GAGCCAACCTCTGGTCTCGGGATCATTCTGGACA

GTGTGTGTGGGATGTTTCCCCATCTCCTTTCCCCACTTCTGCAATTGCTCCGAGCCCTCGTGTCAGGGAAGTCCACTGCCAAAAAA GTGTACAGCTTCC

TGGATAAAATGTCTTTCTACAACGAACTCCATAAGCACAAGCCCCATGATGTGCTCTCTCATGAAGATGGAACTCTGTGGCGGAGGCAAACACCCAAACT

CCTGTACCCTCTAG - UNI5346 - GGGGTCAGACCAACCTTCGCATTCCTCAGGGCACTGTGGGCCAAGTCATGCTGGATGACAGGGCTTACCTTGT

CCGCTGGGAGTACTCTTACAGCAGCTGGACCCTCTTCACCTGCGAGATTGAAATGCTGCTCCACGTTGTCTCCACAGCAG ATGTGATCCAGCATTGCCA

GCGGGTCAAGCCCATCATTGATTTGGTTCATAAGGTCATCAGCACAGACTTGTCCATAGCAGACTGCCTGCTGCCCATCACATCCCGCATCTACATGCTG

TTGCAGCG GCTGACGACGGTGATCTCCCCTCCTGTAAACGTCATTGCTTCTTGTGTCAACTGCTTAACTGTCTTGGCTGCTCGAAACCCAGCAAAG GT

CTGGACTGATCTTCGTCACACAGGTTTTTTGCCATTCGTGGCCCACCCTGTCTCCAACATGACTCAGATGATTAG - UNI8713 - TGCGGAGGGAAT

GAATGCTGGAGGGTATGGCAGCCTTCTGATGAACAGTGAGCAGCCCCAGGGCGAATATGGGGTCACCATTGCCTTTCTGCGCCTGGTCACCACGCTTGTC

AAG GGGCAGCTTGGTAGTACCCAGAGCCAAGGCCTGGTGCCTTGTGTGATGTTCGTGTTGAAGGAGATGCTTCCCAGCTACCACAAATGGCGCTACAAC

TCTCATGGCGTGCGAGAGCTGATAG GTTGCCTAATTCTGGAGCTGATTCATGCAATACTGAACCTGTGCCAAGAGACAGAGCTGCATAGCAG CCACAC

ACCCAGCCTGCCTTCCCTCTGCATCTGCAGCCTGGCTTATACCGAAGCTGGACAGACCGTCATTAGCATCATGGGAATTGGTGTAGACACCATAGACATG

GTGATGGCTGCTCAGCCCCGCAG TGATGGGCCAGAAGGCCAAGGCCAGGGCCAACTGCTGATCAAGACAGTGAAGCTGGCGTTCTCTGTCACCAACAAT

GTTATTCGGCTGAAACCTCCTTCTAATGTGGTTTCACCCCTGGAACAGGCTCTCACACAACATG GTGCCCACGGGAACAACCTCATTGCTGTCCTAGCC

AAGTACATCTACCACAGACATGACCCAGCCTTGCCACGTCTGGCCATCCAGCTGCTGAAACGCTTGGCCACG GTGGCCCCAATGTCAGTGTATGCTTGC

CTGGGCAGTGATGCAGCGGCCATCCGTGATGCCTTCCTGACCCGCCTTCAGAGCAAGATTGAGGACATGCGCATCAAAGTCATGATCCTGGAGTTCCTGA

CAGTGGCGGTAGAGACACAGCCAGGTCTCATCGAGCTGTTTCTGAATCTGGAGGTGAAGGATGGCAGCAATGGCTCCAAG GAATTCAGCCTTGGTGTGT

GGAGCTGTCTCCATGTGGTGCTGGAGCTGATTGATTCCCAGCAGCAAGATCGATACTGGTGCCCACCTCTGTTGCATCGTGCAGCTATTGCCTTCCTTCA

TGCCCTGTGGCAAGACCGTAGGGACAGTGCAATGCTTGTCCTCAGAACCAA ACCCAAGTTTTGGGAGAATTTAACAAGTCCGCTGTTTGGAACTCTCTC

TCCTCCTTCAGAGACATCTGAG CCCAGTGTCCTGGAAACCTGTGCCCTGATCATGAAGATAATATGTTTGGAGATATACTATGTAGTTAA GGGCTCGT

TAGACCAGTCATTAAAAGATACACTCAAGAAGTTCTCCAGTGAGAAACGCTTTGCCTACTGGTCAGGGTACGTCAAGTCTTTGGCAGTTTACATGGCTGA

CACAGAGGGCAGCAGTTGCACGTCCCTGCTAGAGTATCAGATGCTGGTCTCCGCCTGGAGGATACTTCTCATCATTGCTGCCAGTCAC - UNI16998 

- - UNI35332 - GCAGACGTCATGCACTTGACTGACATGGCAGTGCGGCGCCAGCTGTTTCTTGATGTGCTTGATGGGACCAAAGCATTA - UNI1

6998 - CTCCTTGTGGCAGCATCTGTGAACTGCCTCCGGCTGGGCTCCATGATGTGCACCCTGCTGCTTATCCTCCTACGCCAGTGGAAGAG AGAGCT

GGGTGCTGTGGAGAAAATCCTTGGGCCCTTGACAGAGATCCTGGAAGGGGTGCTTCAGGCAGACCAGCAGCTCATGGAAAAGACCAAGGCCAAGGTGTTC

TCTGCATTCATCACAGTGTTACAGATGAAGGAGCTGCGAG - UNI20300 - TCGGTGATATCCCCCAGTACTCCCAGCTGGTGCTGAACGTCTGTGA

GACTCTCCAAGAAGAGGTGATTGCACTCTTTGATCAGACCCGCCACAGCCTGGCATCCGACAGCGCTGCCGAGGACAAGGACAGCATGGAGACAGATGAC

TGCCCTCGGCCCCGGCACAAGGACCAGCGTGATGGG GTGTGTGTCCTGGGACTGCATCTGGCTAAGGAGCTCTGTGAGGTGGATGAGGATGGGGACTCA

TGGTTGCAGGTGACCCGAAGGCTCCCCATTCTGCCCACGCTGCTCACCACGCTGGAGGTGAGCCTCCGCATGAAGCAGAACCTGCATTTTACTGAGGCTG

CGCTGCACCTGCTCCTCACCCTGGCTCGAACCCAGCAA GGAGCCACAGCAGTGGCTGGAGCTGGCATCACCCAGAGCATCTGTTTGCCCCTCTTGAGTG

TATACCAGCTTAGCAGCAATGGCACAGGACAG ACACCTAGCACCTCTCGAAAGTCCCTGGATGCCCCATCCTGGCCAGGAGTCTACCGCCTGTCCATGT

CCTTAATGGAGCGATTGCTCAAGACTCTACGCTACAATTTCCTGACGGAGGCTCTAGACTTTGTGGGTGTCCATCAAGAACGGACCTTGCAG - UNI21

35 - TTTTACCACTCC
Translation
 - UNI14694 -  - UNI19466 -  - UNI17926 - - UNI19466 -  - UNI17926 - - UNI27074 -            - UNI53

46 -     - UNI8713 -            - UNI16998 - - UNI35332 -  - UNI16998 -  MKELRV - UNI20300 - VGDIPQY

SQLVLNVCETLQEEVIALFDQTRHSLASDSAAEDKDSMETDDCPRPRHKDQRDG VCVLGLHLAKELCEVDEDGDSWLQVTRRLPILPTLLTTLEVSLRM

KQNLHFTEAALHLLLTLARTQQ GATAVAGAGITQSICLPLLSVYQLSSNGTGQ TPSTSRKSLDAPSWPGVYRLSMSLMERLLKTLRYNFLTEALDFVG

VHQERTLQ - UNI2135 - FYHS
Transcript ENSMUST00000113634
Sequence
GCGCGCGAAGATGGCGGCTGCCGCTGGTGGGCCGTGTGTGAG - UNI14694 - GAGCAGTAGAGAACTCTGGACAATTCTACTTGGGAGGTCAGCTC

TTAGAGAATTG - UNI19466 - AATCAGATTGAGGCGGAACTGAATAAATATTGGCAGCGGTTGTTAGAAGGGCTTTCTTACTACAAACCTCCCAG 

- UNI17926 - - UNI19466 - TCCAAGTTCAGCTGAAAGAGTGAAAGCTAATAAAGACGTAGCGTCACCTCTGAAGGAGCTGGGCCTAAGAGTCA

GCAAGTTCTTG - UNI17926 - - UNI27074 - GGTCTTGATGAAGAGCAGAGTGTGCAGTTACTGCAGTGTTACCTTCAGGAGGATTACAGGGG

TACTCGGGACTCACTAAAG ACAGTCCTGCAAGATGAGAGGCAGAGCCAGGCCTTAACCCTGAAG GGGCCTTCGTTGGGTTCCTGGCACCCGTGGCAGC

TCAGGAATGCCTTACCTCTGGCTCCAGATCCCTCCTTGCCCTTCTTCTTCTGGCCTTGGTAG
Translation
MAAAAGGPCVR - UNI14694 - RSSRELWTILLGRSALREL - UNI19466 - NQIEAELNKYWQRLLEGLSYYKPPS - UNI17926 - - U

NI19466 - SPSSAERVKANKDVASPLKELGLRVSKFL - UNI17926 - - UNI27074 - GLDEEQSVQLLQCYLQEDYRGTRDSLK TVLQDE

RQSQALTLK GPSLGSWHPWQLRNALPLAPDPSLPFFFWPW
Transcript ENSMUST00000064447
Sequence
GCGAAGATGGCGGCTGCCGCTGGTGGGCCGTGTGTGAG - UNI14694 - GAGCAGTAGAGAACTCTGGACAATTCTACTTGGGAGGTCAGCTCTTAG

AGAATTG - UNI19466 - AATCAGATTGAGGCGGAACTGAATAAATATTGGCAGCGGTTGTTAGAAGGGCTTTCTTACTACAAACCTCCCAG - UN

I17926 - - UNI19466 - TCCAAGTTCAGCTGAAAGAGTGAAAGCTAATAAAGACGTAGCGTCACCTCTGAAGGAGCTGGGCCTAAGAGTCAGCAA

GTTCTTG - UNI17926 - - UNI27074 - GGTCTTGATGAAGAGCAGAGTGTGCAGTTACTGCAGTGTTACCTTCAGGAGGATTACAGGGGTACT

CGGGACTCACTAAAG ACAGTCCTGCAAGATGAGAGGCAGAGCCAGGCCTTAACCCTGAAG ATTGCAGATTATTATTATGAAGAAAGAACCTGCATTCT

TCGTTGTGTCTTACACCTTCTGACATATTTCCAAGATGAACGCCATCCATACAGG GCGGAATATGCTGACTGTGTTGACAAACTGGAGAAGGAACTAGT

TTTAAAGTACCGGCAGCAGTTTGAGGAGCTGTATAGAACAGAAGCACCAACCTGGGAGACGCATGGCAACCTCATG ACTGAGCGTCAGGTGTCGCGGTG

GTTGGTTCAGTGCCTCCGGGAACAGTCCATGCTGTTAGAAATTATTTTCCTTTATTATGCATACTTCGAGATGGCACCAAGTGACCTATTGGTACTAACC

AAGATGTTCAAGGAGCAAGGGTTTGGTAGTAGGCAGACCAGCAGGCACCTTGTGGGTGGAACCATGGATCCTTTTGTAGATCGCATTGG GTACTTCAGT

GCCCTCATCCTGGTGGAAGGGATGGACATCGAGTCCCTGCACAAGTACGCCTTGGATGACAGGCGAGAGCTGCACCAGTTTGCTCAGGATGGCCTCATCT

GCCAG GACATGGACCGAGCGATGTTGACCTTGGGAGACATTCCGCACCACGCCCCTGTGCTTTTAGCCTGGGCTCTCCTCCGTCACACACTGAGCCCAG

AAGAGACCAGCAGTGTGGTCAGGAAGATAGGGGGCACGGCCATCCAGCTGAATGTGTTTCAGTACTTGACTCGACTGCTTCGGTCACTTGCCAGTGGAGG

AAATGAT TGCACCACGAGCACCGCCTGCATGTGTGTCTATGGTCTTCTCTCCTTTGCCCTCACCTCACTGGAGCTGCACACACTGGGCAACCAGCAG G

ATGTCATTGACACAGCATGTGAAGTCCTGGCAGACCCTTCCCTTCCAGAGCTGTTCTGGGGAACA GAGCCAACCTCTGGTCTCGGGATCATTCTGGACA

GTGTGTGTGGGATGTTTCCCCATCTCCTTTCCCCACTTCTGCAATTGCTCCGAGCCCTCGTGTCAGGGAAGTCCACTGCCAAAAAA GTGTACAGCTTCC

TGGATAAAATGTCTTTCTACAACGAACTCCATAAGCACAAGCCCCATGATGTGCTCTCTCATGAAGATGGAACTCTGTGGCGGAGGCAAACACCCAAACT

CCTGTACCCTCTAG - UNI5346 - GGGGTCAGACCAACCTTCGCATTCCTCAGGGCACTGTGGGCCAAGTCATGCTGGATGACAGGGCTTACCTTGT

CCGCTGGGAGTACTCTTACAGCAGCTGGACCCTCTTCACCTGCGAGATTGAAATGCTGCTCCACGTTGTCTCCACAGCAG ATGTGATCCAGCATTGCCA

GCGGGTCAAGCCCATCATTGATTTGGTTCATAAGGTCATCAGCACAGACTTGTCCATAGCAGACTGCCTGCTGCCCATCACATCCCGCATCTACATGCTG

TTGCAGCG GCTGACGACGGTGATCTCCCCTCCTGTAAACGTCATTGCTTCTTGTGTCAACTGCTTAACTGTCTTGGCTGCTCGAAACCCAGCAAAG GT

CTGGACTGATCTTCGTCACACAGGTTTTTTGCCATTCGTGGCCCACCCTGTCTCCAACATGACTCAGATGATTAG - UNI8713 - TGCGGAGGGAAT

GAATGCTGGAGGGTATGGCAGCCTTCTGATGAACAGTGAGCAGCCCCAGGGCGAATATGGGGTCACCATTGCCTTTCTGCGCCTGGTCACCACGCTTGTC

AAG GGGCAGCTTGGTAGTACCCAGAGCCAAGGCCTGGTGCCTTGTGTGATGTTCGTGTTGAAGGAGATGCTTCCCAGCTACCACAAATGGCGCTACAAC

TCTCATGGCGTGCGAGAGCTGATAG GTTGCCTAATTCTGGAGCTGATTCATGCAATACTGAACCTGTGCCAAGAGACAGAGCTGCATAGCAG CCACAC

ACCCAGCCTGCCTTCCCTCTGCATCTGCAGCCTGGCTTATACCGAAGCTGGACAGACCGTCATTAGCATCATGGGAATTGGTGTAGACACCATAGACATG

GTGATGGCTGCTCAGCCCCGCAG TGATGGGCCAGAAGGCCAAGGCCAGGGCCAACTGCTGATCAAGACAGTGAAGCTGGCGTTCTCTGTCACCAACAAT

GTTATTCGGCTGAAACCTCCTTCTAATGTGGTTTCACCCCTGGAACAGGCTCTCACACAACATG GTGCCCACGGGAACAACCTCATTGCTGTCCTAGCC

AAGTACATCTACCACAGACATGACCCAGCCTTGCCACGTCTGGCCATCCAGCTGCTGAAACGCTTGGCCACG GTGGCCCCAATGTCAGTGTATGCTTGC

CTGGGCAGTGATGCAGCGGCCATCCGTGATGCCTTCCTGACCCGCCTTCAGAGCAAGATTGAGGACATGCGCATCAAAGTCATGATCCTGGAGTTCCTGA

CAGTGGCGGTAGAGACACAGCCAGGTCTCATCGAGCTGTTTCTGAATCTGGAGGTGAAGGATGGCAGCAATGGCTCCAAG GAATTCAGCCTTGGTGTGT

GGAGCTGTCTCCATGTGGTGCTGGAGCTGATTGATTCCCAGCAGCAAGATCGATACTGGTGCCCACCTCTGTTGCATCGTGCAGCTATTGCCTTCCTTCA

TGCCCTGTGGCAAGACCGTAGGGACAGTGCAATGCTTGTCCTCAGAACCAA ACCCAAGTTTTGGGAGAATTTAACAAGTCCGCTGTTTGGAACTCTCTC

TCCTCCTTCAGAGACATCTGAG CCCAGTGTCCTGGAAACCTGTGCCCTGATCATGAAGATAATATGTTTGGAGATATACTATGTAGTTAA GGGCTCGT

TAGACCAGTCATTAAAAGATACACTCAAGAAGTTCTCCAGTGAGAAACGCTTTGCCTACTGGTCAGGGTACGTCAAGTCTTTGGCAGTTTACATGGCTGA

CACAGAGGGCAGCAGTTGCACGTCCCTGCTAGAGTATCAGATGCTGGTCTCCGCCTGGAGGATACTTCTCATCATTGCTGCCAGTCAC - UNI16998 

- - UNI35332 - GCAGACGTCATGCACTTGACTGACATGGCAGTGCGGCGCCAGCTGTTTCTTGATGTGCTTGATGGGACCAAAGCATTA - UNI1

6998 - CTCCTTGTGGCAGCATCTGTGAACTGCCTCCGGCTGGGCTCCATGATGTGCACCCTGCTGCTTATCCTCCTACGCCAGTGGAAGAG AGAGCT

GGGTGCTGTGGAGAAAATCCTTGGGCCCTTGACAGAGATCCTGGAAGGGGTGCTTCAGGCAGACCAGCAGCTCATGGAAAAGACCAAGGCCAAGGTGTTC

TCTGCATTCATCACAGTGTTACAGATGAAGGAGCTGCGAG - UNI20300 - TCGGTGATATCCCCCAGTACTCCCAGCTGGTGCTGAACGTCTGTGA

GACTCTCCAAGAAGAGGTGATTGCACTCTTTGATCAGACCCGCCACAGCCTGGCATCCGACAGCGCTGCCGAGGACAAGGACAGCATGGAGACAGATGAC

TGCCCTCGGCCCCGGCACAAGGACCAGCGTGATGGG GTGTGTGTCCTGGGACTGCATCTGGCTAAGGAGCTCTGTGAGGTGGATGAGGATGGGGACTCA

TGGTTGCAGGTGACCCGAAGGCTCCCCATTCTGCCCACGCTGCTCACCACGCTGGAGGTGAGCCTCCGCATGAAGCAGAACCTGCATTTTACTGAGGCTG

CGCTGCACCTGCTCCTCACCCTGGCTCGAACCCAGCAA GGAGCCACAGCAGTGGCTGGAGCTGGCATCACCCAGAGCATCTGTTTGCCCCTCTTGAGTG

TATACCAGCTTAGCAGCAATGGCACAGGACAG ACACCTAGCACCTCTCGAAAGTCCCTGGATGCCCCATCCTGGCCAGGAGTCTACCGCCTGTCCATGT

CCTTAATGGAGCGATTGCTCAAGACTCTACGCTACAATTTCCTGACGGAGGCTCTAGACTTTGTGGGTGTCCATCAAGAACGGACCTTGCAG - UNI21

35 - TGTCTCAATGCCGTGAAGACAGTGCAGAGTCTAGCCTGCCTGGAGGAAGCAGATCACACCGTGGGCTTCATCCTACAACTGTCCCACTTCAGGAA

GGAGTGGCACTTCCATCTGCCTCAGCTCATGCGTGATGTTCAG GTGAACCTGGGTTACTTGTGCCAGGCCTGTACCTCCCTCCTGCACAGCCGCAAGAT

GCTGCAGCACTACCTACAG AACAAAAATGGTGATGGCCTCCCTTCAGCTGTCACTCCCCGAGCTCAGCGGCCATCCACCACCACCACCACCACCACCAC

CACCACCGCTCTGGCTACCCCAGCTGGCTGCTCCTCCAAGCAGCCTACTGCTGACACTGAGGCCTCAGAACAGCGAGCCTTACACACAGTCCAGTATGGG

CTTCTCAAGATTCTCAGCAGGACCCTGGCAGCCCTGCGCCACTTCACTCCGGATGTCTGCCAGATCCTGTTGGACCAG TCCCTGGATCTTGCTGAGTAC

AACTTCCTCTTTGCCCTAAGTTTTACCACTCCCACCTTTGACTCTGAAGTGGCTCCCTCCTTCGGAACCCTCTTGGCCACAGTGAACGTGGCCCTCAACA

TGCTTGGAGAG CTGGACAAGAAAAAGGAATCCCTCACCCAGGCTGTGGGACTCAGCACACAAGCAGAAGGGACCCGAACATTAAA GTCCCTCCTGATG

TTCACCATGGAGAACTGCTTCTACCTGCTCATCTCCCAAGCAGTACGCTACCTCAGGGACCCGGCTGTGCACCCCCGGGACAAGCAGCGGATGAAGCAGG

AGCTGAGCTCGGAGCTG AGCACGTTGCTTTCCAGCCTCTCACGATACTTCAGAAGGGGGGCCCCCAGCTCCCCTGCTGCTGGAGTCCTGCCCTCACCAC

AGGGCAAGGCCACCTCTCTCTCCAAAGCCAGCCCAGAATCTCAGGAGCCTCTGATCCAACTTGTGCAAGCCTTTGTCCGGCACGTGCAGAGATAGGGCGC

CGACTGCTGTCTACCTGCTGCTCCTACCAACCTGCACTGCAGCCTGGGTAGAGGGCGCTGCCACCACAAGGCCAGCCACTGAGCAGGCAGCTCCCTTCGT

CGTCCTCCTGCCCACCCGCTGACATTATTTTTATATAGCTAAAGAGGTCAACAGCACGGGCAGGGAGCCAAGGGGCTGGGTGCTCAGACTCTTAACAATA

TCCCAAGGTGGCCCCTTTCCTCCGAGCATTCCCATGGCACTTCACCAGCCAGGGAGGCCCTGGGTGCTGGCAGCACAGGAGAGTCCTGTGTGTAGTGAGG

GTTTTCCATGATCTATTCTTGCAGTTTTTTTGGTAATACCGTGGTCTATTTATACAAATATTAAAAGTGCTGTTTATAG
Translation
MAAAAGGPCVR - UNI14694 - RSSRELWTILLGRSALREL - UNI19466 - NQIEAELNKYWQRLLEGLSYYKPPS - UNI17926 - - U

NI19466 - SPSSAERVKANKDVASPLKELGLRVSKFL - UNI17926 - - UNI27074 - GLDEEQSVQLLQCYLQEDYRGTRDSLK TVLQDE

RQSQALTLK IADYYYEERTCILRCVLHLLTYFQDERHPYR AEYADCVDKLEKELVLKYRQQFEELYRTEAPTWETHGNLM TERQVSRWLVQCLREQS

MLLEIIFLYYAYFEMAPSDLLVLTKMFKEQGFGSRQTSRHLVGGTMDPFVDRIG GYFSALILVEGMDIESLHKYALDDRRELHQFAQDGLICQ DMDRA

MLTLGDIPHHAPVLLAWALLRHTLSPEETSSVVRKIGGTAIQLNVFQYLTRLLRSLASGGND CTTSTACMCVYGLLSFALTSLELHTLGNQQ DVIDTA

CEVLADPSLPELFWGT EPTSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKK VYSFLDKMSFYNELHKHKPHDVLSHEDGTLWRRQTPKLLYPL

G - UNI5346 - GGQTNLRIPQGTVGQVMLDDRAYLVRWEYSYSSWTLFTCEIEMLLHVVSTAD DVIQHCQRVKPIIDLVHKVISTDLSIADCLLPI

TSRIYMLLQR RLTTVISPPVNVIASCVNCLTVLAARNPAK VWTDLRHTGFLPFVAHPVSNMTQMIS - UNI8713 - SAEGMNAGGYGSLLMNSEQ

PQGEYGVTIAFLRLVTTLVK GQLGSTQSQGLVPCVMFVLKEMLPSYHKWRYNSHGVRELIG GCLILELIHAILNLCQETELHSS SHTPSLPSLCICS

LAYTEAGQTVISIMGIGVDTIDMVMAAQPRS SDGPEGQGQGQLLIKTVKLAFSVTNNVIRLKPPSNVVSPLEQALTQHG GAHGNNLIAVLAKYIYHRH

DPALPRLAIQLLKRLAT VAPMSVYACLGSDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVETQPGLIELFLNLEVKDGSNGSK EFSLGVWSCLHV

VLELIDSQQQDRYWCPPLLHRAAIAFLHALWQDRRDSAMLVLRTK KPKFWENLTSPLFGTLSPPSETSE PSVLETCALIMKIICLEIYYVVK KGSLD

QSLKDTLKKFSSEKRFAYWSGYVKSLAVYMADTEGSSCTSLLEYQMLVSAWRILLIIAASH - UNI16998 - - UNI35332 - ADVMHLTDMAVR

RQLFLDVLDGTKAL - UNI16998 - LLVAASVNCLRLGSMMCTLLLILLRQWKR RELGAVEKILGPLTEILEGVLQADQQLMEKTKAKVFSAFITV

LQMKELRV - UNI20300 - VGDIPQYSQLVLNVCETLQEEVIALFDQTRHSLASDSAAEDKDSMETDDCPRPRHKDQRDG VCVLGLHLAKELCEVD

EDGDSWLQVTRRLPILPTLLTTLEVSLRMKQNLHFTEAALHLLLTLARTQQ GATAVAGAGITQSICLPLLSVYQLSSNGTGQ TPSTSRKSLDAPSWPG

VYRLSMSLMERLLKTLRYNFLTEALDFVGVHQERTLQ - UNI2135 - CLNAVKTVQSLACLEEADHTVGFILQLSHFRKEWHFHLPQLMRDVQ VNL

GYLCQACTSLLHSRKMLQHYLQ NKNGDGLPSAVTPRAQRPSTTTTTTTTTTALATPAGCSSKQPTADTEASEQRALHTVQYGLLKILSRTLAALRHFTP

DVCQILLDQ SLDLAEYNFLFALSFTTPTFDSEVAPSFGTLLATVNVALNMLGE LDKKKESLTQAVGLSTQAEGTRTLK KSLLMFTMENCFYLLISQA

VRYLRDPAVHPRDKQRMKQELSSEL STLLSSLSRYFRRGAPSSPAAGVLPSPQGKATSLSKASPESQEPLIQLVQAFVRHVQR

For any suggestions or comments, please send an email to unitrap@crg.es