Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052539 (Magi3)
Chromosomal location
Chr 3: 103817548 - 104024161 (-)
Description
membrane associated guanylate kinase, WW and PDZ domain containing 3 Gene [Source:MGI (curated);Acc:Magi3-002]
RefSeq_dna
NM_133853 
RefSeq_peptide
NP_598614.1 
MGI
MGI:1923484 
Uniprot/SWISSPROT
Q9EQJ9 
Uniprot/SPTREMBL
Q8C124 
Human Ortholog
ENSG00000081026 (MAGI3)
Omim not available
UniTrap UNI32599
Vector Insertion
Chr 3: 103909653 - 104023951
Public Clones IST12511C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9560
Vector Insertion
Chr 3: 103855322 - 103858264
Public Clones XG816 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7898
Vector Insertion
Chr 3: 103824345 - 103824859
Public Clones RRM055 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122303
Sequence
CCTTTGCCTCAGCCTTTCCCGCCGCGCGGGCGCCGAGTCCCGGCCGTCGGCGCTGACCCCGCCCGGAGACCCCGCCGGCGCCGCCCGCGGGGCGCGCGCT

CCCTCCGGCTCTCCTCAGCGGCCCGCGAGAGGGGCGGCTCGCGGCGGCGCGCGGCCGGCGGGCTGAGGCGGGGGGTCGACGGCGGCGCCCCTCTGGCCGG

GCTGTGCGCGGGGCCCGGAGCGGCACCGCGGCCGCCCGCGCGGGGGCTCCCCATGGTGCAGCGGAGGTCGGGATGTCGAAGACGTTGAAGAAGAAGAAGC

ACTGGCTCAGCAAGGTGCAGGAGTGTGCGGTATCCTGGGCCGGGCCCCCGGGCGACTTGGGCGCCGAGATCCGCGGCGGCGCCGAGCGCGGCGAGTTCCC

TTACCTGGGGCGGCTCCGCGACGAGGCTGGCGGCGGCGGAGGCACCTGCTGCGTGGTCTCGGGCAAGGCGCCCAGTCCGGGCGATGTGCTGTTGGAGGTG

AACGGGACGCCGGTCAGTGGGCTCACCAACCGGGACACTCTGGCTGTCATCCGCCACTTCCGCGAGCCCATCCGTCTGAAGACGGTGAAGCCAG - UNI

32599 - GCAAAGTTATAAATAAAGATTTGCGACACTACCTGAGTCTTCAGTTTCAGAAAGGATCAATTGACCACAAACTACAGCAAGTCATCAGAGAT

AATCTCTATTTGAGAACCATCCCAT - UNI32599 - GCACTACAAGGGCTCCCAGGGATGGGGAAGTCCCAGGGGTGGATTATAACTTCATTTCTGT

TGAACAATTCAAGGCACTGGAAGAAAGCGGAGCATTGTTAGAAAGTGGAACGTATGATG GAAATTTCTATGGCACACCCAAGCCTCCAGCAGAGCCTAG

TCCTTTCCAGCCCGATCCAGTTGATCAGGTCCTCTTTGACAATGAGTTTGACACAGAATCCCAAAGAAAAAGAACCACATCTGTCAGCAAGATGGAAAGG

ATGGACAGCTCTCTCCCTGAAGAAGAAGAAGATGAGGACAAAGAAGCTGTTAATGGCAGCGGAAGCATGG AAACTAGAGAGATGCATTCTGAGACATCT

GACTGCTGGATGAAGACTGTTCCAAGTTATAACCAAACAAATAGCTCCATGGACTTTAGAAATTATATGATGAGAGATGAGAATCTGGAACCGCTGCCCA

AAAACTGGGAAATGGCCTACACTGACACAGGAATGATCTACTTCATTGA TCATAATACGAAGACAACCACCTGGTTGGATCCTCGTCTCTGCAAGAAAG

CCAAAGCCCCTGAAGACTGTGAAGATGGAG AGCTTCCCTATGGCTGGGAGAAAATAGAGGACCCTCAGTATGGAACATACTACGTTGA TCACCTCAAC

CAGAAAACTCAGTTTGAAAATCCAGTGGAGGAAGCCAAGAGGAAAAAGCAGTTAGGACAGGCTGAAATTCATTCTGCAAAAACAG ATGTGGAAAGAGCA

CACTTTACTCGGGACCCATCCCAACTTAAAGGTGTACTTGTTCGAGCATCGCTGAAAAAAAGCACCATGGGCTTTGGCTTTACCATTATTGGTGGAGATA

GGCCTGATGAATTTCTACAAGTAAAAAACGTGCTCAAAGATGGTCCTGCCGCTCAGGATGGGAAAATTGCACCAG - UNI9560 - GTGATGTTATTG

TAGACATCAATGGCAACTGTGTCCTTGGTCACACCCATGCAGATGTTGTCCAGATGTTTCAACTGGTACCTGTCAACCAGTATGTCAACCTTACTTTATG

CCGTGGTTATCCACTTCCTGATGACAGTGAAGATCCTGTTGTGGACATTGTTGCTGCTACCCCTGTCATCAATGGACAATCTTTAACAAAGGGAGAGACA

TGCATGAATACTCAGGATTTTAAACTGGGAGCAATGGTTTTGGATCAGAATGGAAAATCAGGACAAATCTTGGCCAGTGATCGTCTCAATGGTCCATCTG

AGTCAAGTGAGCAGAGGGCATCTCTGGCATCATCAGGCAGCTCACAGCCTGAACTAGTGACTATCCCTCTGATTAAGGGCCCCAAAGGCTTTGGGTTTGC

AATTGCTGACAGCCCAACTGGACAGAAGGTGAAAATGATATTGGATAGCCAGTGGTGTCAAGGCCTTCAAAAAGGGGATATCATCAAAGAAATTTACCAT

CAGAATGTGCAGAATTTAACACATCTCCAAGTCGTAGAAGTCCTAAAGCAGTTCCCAGTAGGTGCAGATGTTCCATTGCTTATCTTAAGAGGAG GTCCT

TGTTCACCAACTAAAACTGCCAAAACG AAAACAGATACAAAGGAAAATTCAGGAAGTTTGGAGACTATAAATGAGCCTATTCCCCAGCCTATGCCTTTT

CCGCCCAGCATAATCAGATCAGGATCCCCAAAATTGGATCCTTCTGAGGTCTACCTGAAATCTAAGACTTTATATGAAGATAAAC CACCAAACACCAAA

GATCTGGATGTCTTTCTTCGGAAACAAGAATCAGGGTTTGGCTTCAGGGTGCTAGGAGGAGATGGACCTGACCAGTCT ATATATATTGGGGCCATCATT

CCCCTGGGAGCAGCTGAAAAAGATGGTAGGCTCCGTGCTGCTGATGAATTGATGTGTATTGATGGGATTCCTGTTAAAGGAAAATCACACAAGCAAGTAT

TAGACTTAATGACTACTGCTGCTCGAAATGGACACGTGCTACTAACTGTCAGGAGGAAGATCTTCTATGGAG AGAAACAACCCGAGGACGAAAGCCATC

AAGCCTTCTCACAGAACGGATCTCCTCGCCTGAATCGGGCAGAGCTTCCAACCAGGTCTGCCCCACAGGAGGCCTATGATGTCACCTTACAGAGGAAAGA

AAATGAAGGGTTTGGTTTTGTCATCCTCACCTCTAAAAGCAAGCCGCCCCCAGGAG TTATTCCTCATAAAATTGGCCGGGTCATAGACGGAAGTCCAGC

TGATCGTTGTGGAGGACTGAAAGTTGGAGATCACATCTCTGCTGTGAATGGGCAGTCCATTGTCGACCTATCCCATGATAATATTGTTCAGCTCATCAAA

GATGCTGGAGTCACCGTCACGCTGACAGTGGTTGCTGAAGAAG AGCATCATGGTCCACCATCAGGAACAAACTCAGCCAGGCAGAGCCCAGCACTACAG

CACAGGCCCATGGGACAAGCACAAGCCAACCACATACCTGGGGACAG AATTGCCCTAGAAGGTGAAATTGGGAGAGATGTCTGCAGTTCTTACAGACAT

TCCTGGTCTGACCATAAGCACCTTGCACAGCCTGACACTGCAGTGATTTCAGTTGTGGGCAGTCGGCACAATCAG - UNI7898 - AGCCTTGGCTGT

TACCCTGTGGAGCTGGAGAGAGGCCCTCGAGGCTTTGGGTTCAGCCTCCGCGGAGGGAAGGAGTACAACATGGGGCTGTTCATCCTGCGCCTGGCCGAGG

ACGGGCCCGCCATCAAAGACGGCAGGATTCAC GTTGGTGACCAGATCGTTGAAATCAATGGGGAACCGACACAAGGCATCACACACACTCGAGCAATTG

AGCTCATTCAGGCTGGTGGGAATAAAGTCCTCCTCCTTCTGAGGCCAGGAACTGGCTTGATACCTGACCACG GTTTGGCTCCTTCCGGTCTGTGCTCCT

ACGTGAAACCTGAGCAACATTAAGGCTTTCAGGGCTTTTCTTGGTCTTTCCTTAAAAAGACTTGGTAAATTTGCATGTCTTTTAAATCACTTCTTTCATT

TTCTTTTTAATTAAAATGATGCTATTAAATACATCTGTTTCTGTCTTCTGCACTTTTTCAATCTCCCTTTGACATTAAATTTGACAGCCTAACAACC
Translation
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPI

RLKTVKPG - UNI32599 - GKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPC - UNI32599 - CTTRAPRDGEVPGVDYNFISVEQF

KALEESGALLESGTYDG GNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSME ETREMHSETS

DCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWEMAYTDTGMIYFID DHNTKTTTWLDPRLCKKAKAPEDCEDGE ELPYGWEKIEDPQYGTYYVD

 DHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTD DVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPG 

- UNI9560 - GDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMVLDQN

GKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQ

FPVGADVPLLILRGG GPCSPTKTAKT KTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKP PPNTKDLDVFLRKQESGF

GFRVLGGDGPDQS IYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGE EKQPEDESHQAFSQNGSPRL

NRAELPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGV VIPHKIGRVIDGSPADRCGGLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLT

VVAEEE EHHGPPSGTNSARQSPALQHRPMGQAQANHIPGDR RIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQ - UNI7898 - S

LGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIH VGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHG GLAP

SGLCSYVKPEQH
Transcript ENSMUST00000064371
Sequence
GGCCCGGAGCGGCACCGCGGCCGCCCGCGCGGGGGCTCCCCATGGTGCAGCGGAGGTCGGGATGTCGAAGACGTTGAAGAAGAAGAAGCACTGGCTCAGC

AAGGTGCAGGAGTGTGCGGTATCCTGGGCCGGGCCCCCGGGCGACTTGGGCGCCGAGATCCGCGGCGGCGCCGAGCGCGGCGAGTTCCCTTACCTGGGGC

GGCTCCGCGACGAGGCTGGCGGCGGCGGAGGCACCTGCTGCGTGGTCTCGGGCAAGGCGCCCAGTCCGGGCGATGTGCTGTTGGAGGTGAACGGGACGCC

GGTCAGTGGGCTCACCAACCGGGACACTCTGGCTGTCATCCGCCACTTCCGCGAGCCCATCCGTCTGAAGACGGTGAAGCCAG - UNI32599 - GCA

AAGTTATAAATAAAGATTTGCGACACTACCTGAGTCTTCAGTTTCAGAAAGGATCAATTGACCACAAACTACAGCAAGTCATCAGAGATAATCTCTATTT

GAGAACCATCCCAT - UNI32599 - GCACTACAAGGGCTCCCAGGGATGGGGAAGTCCCAGGGGTGGATTATAACTTCATTTCTGTTGAACAATTCA

AGGCACTGGAAGAAAGCGGAGCATTGTTAGAAAGTGGAACGTATGATG GAAATTTCTATGGCACACCCAAGCCTCCAGCAGAGCCTAGTCCTTTCCAGC

CCGATCCAGTTGATCAGGTCCTCTTTGACAATGAGTTTGACACAGAATCCCAAAGAAAAAGAACCACATCTGTCAGCAAGATGGAAAGGATGGACAGCTC

TCTCCCTGAAGAAGAAGAAGATGAGGACAAAGAAGCTGTTAATGGCAGCGGAAGCATGG AAACTAGAGAGATGCATTCTGAGACATCTGACTGCTGGAT

GAAGACTGTTCCAAGTTATAACCAAACAAATAGCTCCATGGACTTTAGAAATTATATGATGAGAGATGAGAATCTGGAACCGCTGCCCAAAAACTGGGAA

ATGGCCTACACTGACACAGGAATGATCTACTTCATTGA TCATAATACGAAGACAACCACCTGGTTGGATCCTCGTCTCTGCAAGAAAGCCAAAGCCCCT

GAAGACTGTGAAGATGGAG AGCTTCCCTATGGCTGGGAGAAAATAGAGGACCCTCAGTATGGAACATACTACGTTGA TCACCTCAACCAGAAAACTCA

GTTTGAAAATCCAGTGGAGGAAGCCAAGAGGAAAAAGCAGTTAGGACAGGCTGAAATTCATTCTGCAAAAACAG ATGTGGAAAGAGCACACTTTACTCG

GGACCCATCCCAACTTAAAGGTGTACTTGTTCGAGCATCGCTGAAAAAAAGCACCATGGGCTTTGGCTTTACCATTATTGGTGGAGATAGGCCTGATGAA

TTTCTACAAGTAAAAAACGTGCTCAAAGATGGTCCTGCCGCTCAGGATGGGAAAATTGCACCAG - UNI9560 - GTGATGTTATTGTAGACATCAAT

GGCAACTGTGTCCTTGGTCACACCCATGCAGATGTTGTCCAGATGTTTCAACTGGTACCTGTCAACCAGTATGTCAACCTTACTTTATGCCGTGGTTATC

CACTTCCTGATGACAGTGAAGATCCTGTTGTGGACATTGTTGCTGCTACCCCTGTCATCAATGGACAATCTTTAACAAAGGGAGAGACATGCATGAATAC

TCAGGATTTTAAACTGGGAGCAATGGTTTTGGATCAGAATGGAAAATCAGGACAAATCTTGGCCAGTGATCGTCTCAATGGTCCATCTGAGTCAAGTGAG

CAGAGGGCATCTCTGGCATCATCAGGCAGCTCACAGCCTGAACTAGTGACTATCCCTCTGATTAAGGGCCCCAAAGGCTTTGGGTTTGCAATTGCTGACA

GCCCAACTGGACAGAAGGTGAAAATGATATTGGATAGCCAGTGGTGTCAAGGCCTTCAAAAAGGGGATATCATCAAAGAAATTTACCATCAGAATGTGCA

GAATTTAACACATCTCCAAGTCGTAGAAGTCCTAAAGCAGTTCCCAGTAGGTGCAGATGTTCCATTGCTTATCTTAAGAGGAG GTCCTTGTTCACCAAC

TAAAACTGCCAAAACG AAAACAGATACAAAGGAAAATTCAGGAAGTTTGGAGACTATAAATGAGCCTATTCCCCAGCCTATGCCTTTTCCGCCCAGCAT

AATCAGATCAGGATCCCCAAAATTGGATCCTTCTGAGGTCTACCTGAAATCTAAGACTTTATATGAAGATAAAC CACCAAACACCAAAGATCTGGATGT

CTTTCTTCGGAAACAAGAATCAGGGTTTGGCTTCAGGGTGCTAGGAGGAGATGGACCTGACCAGTCT ATATATATTGGGGCCATCATTCCCCTGGGAGC

AGCTGAAAAAGATGGTAGGCTCCGTGCTGCTGATGAATTGATGTGTATTGATGGGATTCCTGTTAAAGGAAAATCACACAAGCAAGTATTAGACTTAATG

ACTACTGCTGCTCGAAATGGACACGTGCTACTAACTGTCAGGAGGAAGATCTTCTATGGAG AGAAACAACCCGAGGACGAAAGCCATCAAGCCTTCTCA

CAGAACGGATCTCCTCGCCTGAATCGGGCAGAGCTTCCAACCAGGTCTGCCCCACAGGAGGCCTATGATGTCACCTTACAGAGGAAAGAAAATGAAGGGT

TTGGTTTTGTCATCCTCACCTCTAAAAGCAAGCCGCCCCCAGGAG TTATTCCTCATAAAATTGGCCGGGTCATAGACGGAAGTCCAGCTGATCGTTGTG

GAGGACTGAAAGTTGGAGATCACATCTCTGCTGTGAATGGGCAGTCCATTGTCGACCTATCCCATGATAATATTGTTCAGCTCATCAAAGATGCTGGAGT

CACCGTCACGCTGACAGTGGTTGCTGAAGAAG AGCATCATGGTCCACCATCAGGAACAAACTCAGCCAGGCAGAGCCCAGCACTACAGCACAGGCCCAT

GGGACAAGCACAAGCCAACCACATACCTGGGGACAG AATTGCCCTAGAAGGTGAAATTGGGAGAGATGTCTGCAGTTCTTACAGACATTCCTGGTCTGA

CCATAAGCACCTTGCACAGCCTGACACTGCAGTGATTTCAGTTGTGGGCAGTCGGCACAATCAG - UNI7898 - AGCCTTGGCTGTTACCCTGTGGA

GCTGGAGAGAGGCCCTCGAGGCTTTGGGTTCAGCCTCCGCGGAGGGAAGGAGTACAACATGGGGCTGTTCATCCTGCGCCTGGCCGAGGACGGGCCCGCC

ATCAAAGACGGCAGGATTCAC GTTGGTGACCAGATCGTTGAAATCAATGGGGAACCGACACAAGGCATCACACACACTCGAGCAATTGAGCTCATTCAG

GCTGGTGGGAATAAAGTCCTCCTCCTTCTGAGGCCAGGAACTGGCTTGATACCTGACCACG GTTTGGCTCCTTCCGGTCTGTGCTCCTACGTGAAACCT

GAGCAACATTAAGGCTTTCAGGGCTTTTCTTGGTCTTTCCTTAAAAAGACTTG GTGATTGGGATACTAATAGTCCTTCATCTTCCAATGTCATTTATGA

TGAACAGCCGCCACCTCTCCCATCTTCACATTCTGCTTCCACATTTGAAGAGTCTCATGTGCCAGCAACTGAAGACTCTCTGACTAGAGTTCAGATATGT

GAAAAGGCAGAAGAATTAAAGGACACTGTACAAGAAAAGAAAAGCACTTTAAATGGAAGCCAGCCTGAGATGAAGTATCAGTCTGTCCACAAAACTATGA

GTAAGAAGGATCCACCCAGAGGTTCCGGGCATGGCGAGAAGAGTCGACTAAAAGGAGAAAATGGTGTTACACGGAGAGGTAGATCTGCTAGTCCCAAAAA

GTCAGTTAACCGACATTCAGAGGAACATTTGGAAAAGATTCCCAGGCCCCTAAAAAGTGATCCCAAAGAAAAATCTAGAGACCGCTCACTGAGCCCTAGG

AAAGGAGAAAGTAAAGGTCGGCTCACCATTAAGGCGGGCTCTGGACAAGATCCCAATAGAAAAGACAGAGGACGGTCTTCTAGCCCCAAGAAGCAGCAAA

AGATAGGAGGCAACAGCCTGTCAAACACTGAAGGCAAATTATCAGAGGCTGGGAGCCGAAGAGCAGCAGGCCACCCTAGAGACAGCACTGAACAGCTCCC

AGATGGGAGAGAAAAGTCAGGGGTCAGCAGGAAAGATCTGAAGCAGAGTCAGCCAGGAAAAACCAGAACCAAGTCTCCAGAGAAAAAGAGCAGTAAAGTT

GATGAAACATCTCTCCCATCCAAAAAGACTAGCAGCACTGCTGGTAGGGTAGTATCTGAAAA
Translation
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPI

RLKTVKPG - UNI32599 - GKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPC - UNI32599 - CTTRAPRDGEVPGVDYNFISVEQF

KALEESGALLESGTYDG GNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSME ETREMHSETS

DCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWEMAYTDTGMIYFID DHNTKTTTWLDPRLCKKAKAPEDCEDGE ELPYGWEKIEDPQYGTYYVD

 DHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTD DVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPG 

- UNI9560 - GDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMVLDQN

GKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQ

FPVGADVPLLILRGG GPCSPTKTAKT KTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKP PPNTKDLDVFLRKQESGF

GFRVLGGDGPDQS IYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGE EKQPEDESHQAFSQNGSPRL

NRAELPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGV VIPHKIGRVIDGSPADRCGGLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLT

VVAEEE EHHGPPSGTNSARQSPALQHRPMGQAQANHIPGDR RIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQ - UNI7898 - S

LGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIH VGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHG GLAP

SGLCSYVKPEQH 
Transcript ENSMUST00000121198
Sequence
GGCTCGCGGCGGCGCGCGGCCGGCGGGCTGAGGCGGGGGGTCGACGGCGGCGCCCCTCTGGCCGGGCTGTGCGCGGGGCCCGGAGCGGCACCGCGGCCGC

CCGCGCGGGGGCTCCCCATGGTGCAGCGGAGGTCGGGATGTCGAAGACGTTGAAGAAGAAGAAGCACTGGCTCAGCAAGGTGCAGGAGTGTGCGGTATCC

TGGGCCGGGCCCCCGGGCGACTTGGGCGCCGAGATCCGCGGCGGCGCCGAGCGCGGCGAGTTCCCTTACCTGGGGCGGCTCCGCGACGAGGCTGGCGGCG

GCGGAGGCACCTGCTGCGTGGTCTCGGGCAAGGCGCCCAGTCCGGGCGATGTGCTGTTGGAGGTGAACGGGACGCCGGTCAGTGGGCTCACCAACCGGGA

CACTCTGGCTGTCATCCGCCACTTCCGCGAGCCCATCCGTCTGAAGACGGTGAAGCCAG - UNI32599 - GCAAAGTTATAAATAAAGATTTGCGAC

ACTACCTGAGTCTTCAGTTTCAGAAAGGATCAATTGACCACAAACTACAGCAAGTCATCAGAGATAATCTCTATTTGAGAACCATCCCAT - UNI3259

9 - GCACTACAAGGGCTCCCAGGGATGGGGAAGTCCCAGGGGTGGATTATAACTTCATTTCTGTTGAACAATTCAAGGCACTGGAAGAAAGCGGAGCAT

TGTTAGAAAGTGGAACGTATGATG GAAATTTCTATGGCACACCCAAGCCTCCAGCAGAGCCTAGTCCTTTCCAGCCCGATCCAGTTGATCAGGTCCTCT

TTGACAATGAGTTTGACACAGAATCCCAAAGAAAAAGAACCACATCTGTCAGCAAGATGGAAAGGATGGACAGCTCTCTCCCTGAAGAAGAAGAAGATGA

GGACAAAGAAGCTGTTAATGGCAGCGGAAGCATGG AAACTAGAGAGATGCATTCTGAGACATCTGACTGCTGGATGAAGACTGTTCCAAGTTATAACCA

AACAAATAGCTCCATGGACTTTAGAAATTATATGATGAGAGATGAGAATCTGGAACCGCTGCCCAAAAACTGGGAAATGGCCTACACTGACACAGGAATG

ATCTACTTCATTGA TCATAATACGAAGACAACCACCTGGTTGGATCCTCGTCTCTGCAAGAAAGCCAAAGCCCCTGAAGACTGTGAAGATGGAG AGCT

TCCCTATGGCTGGGAGAAAATAGAGGACCCTCAGTATGGAACATACTACGTTGA TCACCTCAACCAGAAAACTCAGTTTGAAAATCCAGTGGAGGAAGC

CAAGAGGAAAAAGCAGTTAGGACAGGCTGAAATTCATTCTGCAAAAACAG ATGTGGAAAGAGCACACTTTACTCGGGACCCATCCCAACTTAAAGGTGT

ACTTGTTCGAGCATCGCTGAAAAAAAGCACCATGGGCTTTGGCTTTACCATTATTGGTGGAGATAGGCCTGATGAATTTCTACAAGTAAAAAACGTGCTC

AAAGATGGTCCTGCCGCTCAGGATGGGAAAATTGCACCAG - UNI9560 - GTGATGTTATTGTAGACATCAATGGCAACTGTGTCCTTGGTCACACC

CATGCAGATGTTGTCCAGATGTTTCAACTGGTACCTGTCAACCAGTATGTCAACCTTACTTTATGCCGTGGTTATCCACTTCCTGATGACAGTGAAGATC

CTGTTGTGGACATTGTTGCTGCTACCCCTGTCATCAATGGACAATCTTTAACAAAGGGAGAGACATGCATGAATACTCAGGATTTTAAACTGGGAGCAAT

GGTTTTGGATCAGAATGGAAAATCAGGACAAATCTTGGCCAGTGATCGTCTCAATGGTCCATCTGAGTCAAGTGAGCAGAGGGCATCTCTGGCATCATCA

GGCAGCTCACAGCCTGAACTAGTGACTATCCCTCTGATTAAGGGCCCCAAAGGCTTTGGGTTTGCAATTGCTGACAGCCCAACTGGACAGAAGGTGAAAA

TGATATTGGATAGCCAGTGGTGTCAAGGCCTTCAAAAAGGGGATATCATCAAAGAAATTTACCATCAGAATGTGCAGAATTTAACACATCTCCAAGTCGT

AGAAGTCCTAAAGCAGTTCCCAGTAGGTGCAGATGTTCCATTGCTTATCTTAAGAGGAG GTCCTTGTTCACCAACTAAAACTGCCAAAACG AAAACAG

ATACAAAGGAAAATTCAGGAAGTTTGGAGACTATAAATGAGCCTATTCCCCAGCCTATGCCTTTTCCGCCCAGCATAATCAGATCAGGATCCCCAAAATT

GGATCCTTCTGAGGTCTACCTGAAATCTAAGACTTTATATGAAGATAAAC CACCAAACACCAAAGATCTGGATGTCTTTCTTCGGAAACAAGAATCAGG

GTTTGGCTTCAGGGTGCTAGGAGGAGATGGACCTGACCAGTCT ATATATATTGGGGCCATCATTCCCCTGGGAGCAGCTGAAAAAGATGGTAGGCTCCG

TGCTGCTGATGAATTGATGTGTATTGATGGGATTCCTGTTAAAGGAAAATCACACAAGCAAGTATTAGACTTAATGACTACTGCTGCTCGAAATGGACAC

GTGCTACTAACTGTCAGGAGGAAGATCTTCTATGGAG AGAAACAACCCGAGGACGAAAGCCATCAAGCCTTCTCACAGAACGGATCTCCTCGCCTGAAT

CGGGCAGAGCTTCCAACCAGGTCTGCCCCACAGGAGGCCTATGATGTCACCTTACAGAGGAAAGAAAATGAAGGGTTTGGTTTTGTCATCCTCACCTCTA

AAAGCAAGCCGCCCCCAGGAG TTATTCCTCATAAAATTGGCCGGGTCATAGACGGAAGTCCAGCTGATCGTTGTGGAGGACTGAAAGTTGGAGATCACA

TCTCTGCTGTGAATGGGCAGTCCATTGTCGACCTATCCCATGATAATATTGTTCAGCTCATCAAAGATGCTGGAGTCACCGTCACGCTGACAGTGGTTGC

TGAAGAAG AGCATCATGGTCCACCATCAGGAACAAACTCAGCCAGGCAGAGCCCAGCACTACAGCACAGGCCCATGGGACAAGCACAAGCCAACCACAT

ACCTGGGGACAG AATTGCCCTAGAAGGTGAAATTGGGAGAGATGTCTGCAGTTCTTACAGACATTCCTGGTCTGACCATAAGCACCTTGCACAGCCTGA

CACTGCAGTGATTTCAGTTGTGGGCAGTCGGCACAATCAG - UNI7898 - AGCCTTGGCTGTTACCCTGTGGAGCTGGAGAGAGGCCCTCGAGGCTT

TGGGTTCAGCCTCCGCGGAGGGAAGGAGTACAACATGGGGCTGTTCATCCTGCGCCTGGCCGAGGACGGGCCCGCCATCAAAGACGGCAGGATTCAC GT

TGGTGACCAGATCGTTGAAATCAATGGGGAACCGACACAAGGCATCACACACACTCGAGCAATTGAGCTCATTCAGGCTGGTGGGAATAAAGTCCTCCTC

CTTCTGAGGCCAGGAACTGGCTTGATACCTGACCACG GTGATTGGGATACTAATAGTCCTTCATCTTCCAATGTCATTTATGATGAACAGCCGCCACCT

CTCCCATCTTCACATTCTGCTTCCACATTTGAAGAGTCTCATGTGCCAGCAACTGAAGACTCTCTGACTAGAGTTCAGATATGTGAAAAGGCAGAAGAAT

TAAAGGACACTGTACAAGAAAAGAAAAGCACTTTAAATGGAAGCCAGCCTGAGATGAAGTATCAGTCTGTCCACAAAACTATGAGTAAGAAGGATCCACC

CAGAGGTTCCGGGCATGGCGAGAAGAGTCGACTAAAAGGAGAAAATGGTGTTACACGGAGAGGTAGATCTGCTAGTCCCAAAAAGTCAGTTAACCGACAT

TCAGAGGAACATTTGGAAAAGATTCCCAGGCCCCTAAAAAGTGATCCCAAAGAAAAATCTAGAGACCGCTCACTGAGCCCTAGGAAAGGAGAAAGTAAAG

GTCGGCTCACCATTAAGGCGGGCTCTGGACAAGATCCCAATAGAAAAGACAGAGGACGGTCTTCTAGCCCCAAGAAGCAGCAAAAGATAGGAGGCAACAG

CCTGTCAAACACTGAAGGCAAATTATCAGAGGCTGGGAGCCGAAGAGCAGCAGGCCACCCTAGAGACAGCACTGAACAGCTCCCAGATGGGAGAGAAAAG

TCAGGGGTCAGCAGGAAAGATCTGAAGCAGAGTCAGCCAGGAAAAACCAGAACCAAGTCTCCAGAGAAAAAGAGCAGTAAAGTTGATGAAACATCTCTCC

CATCCAAAAAGACTAGCAGCACTGCTGGTAGGGTAGTATCTGAAAAGGAAAAAGGAAAGAAGCCAACAGCAGGAGAAACAAGTAGAGAAACAGTAGAGCA

CACCCAGATCTCAGCAAAGCAGCTCAAGCAGGAAGCTCAAGAGAAGACGGCATTAGGTAACGCAGACGATCACAAAGGCAGAGAATCAGAGGTCACGGAC

AGATGCAGGGAGCGTGCGGGGTGCACACCTCAAAGTAGCTCTCTAGTCAAGAAAGCACCCATCACTCCAGGACCCTGGAGGGTGCCACGTGCAAATAAAG

TCACAGGCACTACTGGCATGGCTGACAAACAGCTGTGACCTTTCATATAAAACAAAGAAAATTAAGTTGTAATCTTGTGCTAAAAACGCAACATTTTAAG

GGGGAGAGGTGTGGTTTTCCCCCAGAAATTCTTCAATAGCAAGTCGTCAGGCTGCATGAAGGGCTTCTGGGATTGCTGAGAGCCACCTGGCCTGGCCGGC

CCTTTCCTCATGCTCAGGAAGGAGCTACATCCAAGGGCTCCCCTGCCACACCCGCCACCCCCTGCTCGGCTGCTCCCTCAGCCTGACATGATCCTAGCAG

TGAGCTCACAGCTCACTTTGTGTTTGTGCCAAGTTATCTGCTGTATCATGTCTGTTTAATCCTTCCCGTTCTGATATTTCCAGTCATCAAACAGTTCCGT

TTGGCTTGAAGATGTTTTCAATAGCATGTTGCATGTTTACAGAGAGAAATATTCGAGTCCTTGCAGAGGAAGAAATTGTTAGCTCATCATCAAAGTGGGC

ACTTGCCTCTTCTCACAGCTTCTGACCGTCCTAGTTTAAAAAATGCAATTCACAAACATCACATTACAGGAAAGGTCAAATATTATAAATGCTTTTTTAC

AGCTAAGTAAGGTGTTTAAAGTAACTGCTAAAAATATTCCTTACAATTGAATGCTCAAAATGAGAACGTACTCTAAGCAACAGAATTAACAGCCTCCTGC

CATGTTAGCCATCCTTATGTAGTGACAGTGTCTCAGATCACCTGTAGTCTTGAGGGAAGTACAAGAAGCATGTAGAAGTACCGCTTGTTTCTCTTTAAAG

AAAAACTACTACATCTGGATATTTTGATTATTAACCATTAGTCTTTAATATAGTTGAAGACCTAAAATAGTATGTAGATTTTTGTGAGGGACTTAATCAT

GAAGCCAGTTCTACAGTCCACTGCCAGACAAAGCACCAGCTCCTGTGACAGAGGAGCTCATCTAGGGGCAGACACACAAGCATTAGGGATTAGAAACAGA

GCCTGTCTTAGGCTTCCTCAGCAAGTTAGGACTAATATGGTATAGACTGTGTGTGTTGGAACTTTAATTTTTAGCTAATTATTTAAAAACAAAGTTCTCA

GAGTTCTTTTTTAAAATCTAATAAAAATGTTTGCTGAAAGTTGGAGACAATTCTTAAACTCATAAAATAGATCAAGACATTAGTTCCCTGAAGCAGCATT

CAGAAACATCTATAAATACAGACATTCCTCAGACCAAAACTGTCTATTTACGGAGTATTTGAATACTCATTCTGTTACCTTGTGAGTCTGACAAATTCCA

CTGTGACAACTGTACTGGCCCGTTATGACACATGCTTCCATCCAGAACTGTATTTAACCCATCTCAAAACTACTTGAATAGC
Translation
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPI

RLKTVKPG - UNI32599 - GKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPC - UNI32599 - CTTRAPRDGEVPGVDYNFISVEQF

KALEESGALLESGTYDG GNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSME ETREMHSETS

DCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWEMAYTDTGMIYFID DHNTKTTTWLDPRLCKKAKAPEDCEDGE ELPYGWEKIEDPQYGTYYVD

 DHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTD DVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPG 

- UNI9560 - GDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMVLDQN

GKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQ

FPVGADVPLLILRGG GPCSPTKTAKT KTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKP PPNTKDLDVFLRKQESGF

GFRVLGGDGPDQS IYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGE EKQPEDESHQAFSQNGSPRL

NRAELPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGV VIPHKIGRVIDGSPADRCGGLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLT

VVAEEE EHHGPPSGTNSARQSPALQHRPMGQAQANHIPGDR RIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQ - UNI7898 - S

LGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIH VGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHG GDWD

TNSPSSSNVIYDEQPPPLPSSHSASTFEESHVPATEDSLTRVQICEKAEELKDTVQEKKSTLNGSQPEMKYQSVHKTMSKKDPPRGSGHGEKSRLKGENG

VTRRGRSASPKKSVNRHSEEHLEKIPRPLKSDPKEKSRDRSLSPRKGESKGRLTIKAGSGQDPNRKDRGRSSSPKKQQKIGGNSLSNTEGKLSEAGSRRA

AGHPRDSTEQLPDGREKSGVSRKDLKQSQPGKTRTKSPEKKSSKVDETSLPSKKTSSTAGRVVSEKEKGKKPTAGETSRETVEHTQISAKQLKQEAQEKT

ALGNADDHKGRESEVTDRCRERAGCTPQSSSLVKKAPITPGPWRVPRANKVTGTTGMADKQL
Transcript ENSMUST00000098772
Sequence
GGCCCGGAGCGGCACCGCGGCCGCCCGCGCGGGGGCTCCCCATGGTGCAGCGGAGGTCGGGATGTCGAAGACGTTGAAGAAGAAGAAGCACTGGCTCAGC

AAGGTGCAGGAGTGTGCGGTATCCTGGGCCGGGCCCCCGGGCGACTTGGGCGCCGAGATCCGCGGCGGCGCCGAGCGCGGCGAGTTCCCTTACCTGGGGC

GGCTCCGCGACGAGGCTGGCGGCGGCGGAGGCACCTGCTGCGTGGTCTCGGGCAAGGCGCCCAGTCCGGGCGATGTGCTGTTGGAGGTGAACGGGACGCC

GGTCAGTGGGCTCACCAACCGGGACACTCTGGCTGTCATCCGCCACTTCCGCGAGCCCATCCGTCTGAAGACGGTGAAGCCAG - UNI32599 - GCA

AAGTTATAAATAAAGATTTGCGACACTACCTGAGTCTTCAGTTTCAGAAAGGATCAATTGACCACAAACTACAGCAAGTCATCAGAGATAATCTCTATTT

GAGAACCATCCCAT - UNI32599 - GCACTACAAGGGCTCCCAGGGATGGGGAAGTCCCAGGGGTGGATTATAACTTCATTTCTGTTGAACAATTCA

AGGCACTGGAAGAAAGCGGAGCATTGTTAGAAAGTGGAACGTATGATG GAAATTTCTATGGCACACCCAAGCCTCCAGCAGAGCCTAGTCCTTTCCAGC

CCGATCCAGTTGATCAGGTCCTCTTTGACAATGAGTTTGACACAGAATCCCAAAGAAAAAGAACCACATCTGTCAGCAAGATGGAAAGGATGGACAGCTC

TCTCCCTGAAGAAGAAGAAGATGAGGACAAAGAAGCTGTTAATGGCAGCGGAAGCATGG AAACTAGAGAGATGCATTCTGAGACATCTGACTGCTGGAT

GAAGACTGTTCCAAGTTATAACCAAACAAATAGCTCCATGGACTTTAGAAATTATATGATGAGAGATGAGAATCTGGAACCGCTGCCCAAAAACTGGGAA

ATGGCCTACACTGACACAGGAATGATCTACTTCATTGA TCATAATACGAAGACAACCACCTGGTTGGATCCTCGTCTCTGCAAGAAAGCCAAAGCCCCT

GAAGACTGTGAAGATGGAG AGCTTCCCTATGGCTGGGAGAAAATAGAGGACCCTCAGTATGGAACATACTACGTTGA TCACCTCAACCAGAAAACTCA

GTTTGAAAATCCAGTGGAGGAAGCCAAGAGGAAAAAGCAGTTAGGACAGGCTGAAATTCATTCTGCAAAAACAG ATGTGGAAAGAGCACACTTTACTCG

GGACCCATCCCAACTTAAAGGTGTACTTGTTCGAGCATCGCTGAAAAAAAGCACCATGGGCTTTGGCTTTACCATTATTGGTGGAGATAGGCCTGATGAA

TTTCTACAAGTAAAAAACGTGCTCAAAGATGGTCCTGCCGCTCAGGATGGGAAAATTGCACCAG - UNI9560 - GTGATGTTATTGTAGACATCAAT

GGCAACTGTGTCCTTGGTCACACCCATGCAGATGTTGTCCAGATGTTTCAACTGGTACCTGTCAACCAGTATGTCAACCTTACTTTATGCCGTGGTTATC

CACTTCCTGATGACAGTGAAGATCCTGTTGTGGACATTGTTGCTGCTACCCCTGTCATCAATGGACAATCTTTAACAAAGGGAGAGACATGCATGAATAC

TCAGGATTTTAAACTGGGAGCAATGGTTTTGGATCAGAATGGAAAATCAGGACAAATCTTGGCCAGTGATCGTCTCAATGGTCCATCTGAGTCAAGTGAG

CAGAGGGCATCTCTGGCATCATCAGGCAGCTCACAGCCTGAACTAGTGACTATCCCTCTGATTAAGGGCCCCAAAGGCTTTGGGTTTGCAATTGCTGACA

GCCCAACTGGACAGAAGGTGAAAATGATATTGGATAGCCAGTGGTGTCAAGGCCTTCAAAAAGGGGATATCATCAAAGAAATTTACCATCAGAATGTGCA

GAATTTAACACATCTCCAAGTCGTAGAAGTCCTAAAGCAGTTCCCAGTAGGTGCAGATGTTCCATTGCTTATCTTAAGAGGAG GTCCTTGTTCACCAAC

TAAAACTGCCAAAACG AAAACAGATACAAAGGAAAATTCAGGAAGTTTGGAGACTATAAATGAGCCTATTCCCCAGCCTATGCCTTTTCCGCCCAGCAT

AATCAGATCAGGATCCCCAAAATTGGATCCTTCTGAGGTCTACCTGAAATCTAAGACTTTATATGAAGATAAAC CACCAAACACCAAAGATCTGGATGT

CTTTCTTCGGAAACAAGAATCAGGGTTTGGCTTCAGGGTGCTAGGAGGAGATGGACCTGACCAGTCT ATATATATTGGGGCCATCATTCCCCTGGGAGC

AGCTGAAAAAGATGGTAGGCTCCGTGCTGCTGATGAATTGATGTGTATTGATGGGATTCCTGTTAAAGGAAAATCACACAAGCAAGTATTAGACTTAATG

ACTACTGCTGCTCGAAATGGACACGTGCTACTAACTGTCAGGAGGAAGATCTTCTATGGAG AGAAACAACCCGAGGACGAAAGCCATCAAGCCTTCTCA

CAGAACGGATCTCCTCGCCTGAATCGGGCAGAGCTTCCAACCAGGTCTGCCCCACAGGAGGCCTATGATGTCACCTTACAGAGGAAAGAAAATGAAGGGT

TTGGTTTTGTCATCCTCACCTCTAAAAGCAAGCCGCCCCCAGGAG TTATTCCTCATAAAATTGGCCGGGTCATAGACGGAAGTCCAGCTGATCGTTGTG

GAGGACTGAAAGTTGGAGATCACATCTCTGCTGTGAATGGGCAGTCCATTGTCGACCTATCCCATGATAATATTGTTCAGCTCATCAAAGATGCTGGAGT

CACCGTCACGCTGACAGTGGTTGCTGAAGAAG AGCATCATGGTCCACCATCAGGAACAAACTCAGCCAGGCAGAGCCCAGCACTACAGCACAGGCCCAT

GGGACAAGCACAAGCCAACCACATACCTGGGGACAG AATTGCCCTAGAAGGTGAAATTGGGAGAGATGTCTGCAGTTCTTACAGACATTCCTGGTCTGA

CCATAAGCACCTTGCACAGCCTGACACTGCAGTGATTTCAGTTGTGGGCAGTCGGCACAATCAG - UNI7898 - AGCCTTGGCTGTTACCCTGTGGA

GCTGGAGAGAGGCCCTCGAGGCTTTGGGTTCAGCCTCCGCGGAGGGAAGGAGTACAACATGGGGCTGTTCATCCTGCGCCTGGCCGAGGACGGGCCCGCC

ATCAAAGACGGCAGGATTCAC GTTGGTGACCAGATCGTTGAAATCAATGGGGAACCGACACAAGGCATCACACACACTCGAGCAATTGAGCTCATTCAG

GCTGGTGGGAATAAAGTCCTCCTCCTTCTGAGGCCAGGAACTGGCTTGATACCTGACCACG GTTTGGCTCCTTCCGGTCTGTGCTCCTACGTGAAACCT

GAGCAACAT GCTTTCAGGGCTTTTCTTGGTCTTTCCTTAAAAAGACTTG GTGATTGGGATACTAATAGTCCTTCATCTTCCAATGTCATTTATGATGA

ACAGCCGCCACCTCTCCCATCTTCACATTCTGCTTCCACATTTGAAGAGTCTCATGTGCCAGCAACTGAAGACTCTCTGACTAGAGTTCAGATATGTGAA

AAGGCAGAAGAATTAAAGGACACTGTACAAGAAAAGAAAAGCACTTTAAATGGAAGCCAGCCTGAGATGAAGTATCAGTCTGTCCACAAAACTATGAGTA

AGAAGGATCCACCCAGAGGTTCCGGGCATGGCGAGAAGAGTCGACTAAAAGGAGAAAATGGTGTTACACGGAGAGGTAGATCTGCTAGTCCCAAAAAGTC

AGTTAACCGACATTCAGAGGAACATTTGGAAAAGATTCCCAGGCCCCTAAAAAGTGATCCCAAAGAAAAATCTAGAGACCGCTCACTGAGCCCTAGGAAA

GGAGAAAGTAAAGGTCGGCTCACCATTAAGGCGGGCTCTGGACAAGATCCCAATAGAAAAGACAGAGGACGGTCTTCTAGCCCCAAGAAGCAGCAAAAGA

TAGGAGGCAACAGCCTGTCAAACACTGAAGGCAAATTATCAGAGGCTGGGAGCCGAAGAGCAGCAGGCCACCCTAGAGACAGCACTGAACAGCTCCCAGA

TGGGAGAGAAAAGTCAGGGGTCAGCAGGAAAGATCTGAAGCAGAGTCAGCCAGGAAAAACCAGAACCAAGTCTCCAGAGAAAAAGAGCAGTAAAGTTGAT

GAAACATCTCTCCCATCCAAAAAGACTAGCAGCACTGCTGGTAGGGTAGTATCTGAAAAGGAAAAAGGAAAGAAGCCAACAGCAGGAGAAACAAGTAGAG

AAACAGTAGAGCACACCCAGATCTCAGCAAAGCAGCTCAAGCAGGAAGCTCAAGAGAAGACGGCATTAGGTAACGCAGACGATCACAAAGGCAGAGAATC

AGAGGTCACGGACAGATGCAGGGAGCGTGCGGGGTGCACACCTCAAAGTAGCTCTCTAGTCAAGAAAGCACCCATCACTCCAGGACCCTGGAGGGTGCCA

CGTGCAAATAAAGTCACAGGCACTACTGGCATGGCTGACAAACAGCTGTGA
Translation
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLRDEAGGGGGTCCVVSGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPI

RLKTVKPG - UNI32599 - GKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPC - UNI32599 - CTTRAPRDGEVPGVDYNFISVEQF

KALEESGALLESGTYDG GNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKEAVNGSGSME ETREMHSETS

DCWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWEMAYTDTGMIYFID DHNTKTTTWLDPRLCKKAKAPEDCEDGE ELPYGWEKIEDPQYGTYYVD

 DHLNQKTQFENPVEEAKRKKQLGQAEIHSAKTD DVERAHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPG 

- UNI9560 - GDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDSEDPVVDIVAATPVINGQSLTKGETCMNTQDFKLGAMVLDQN

GKSGQILASDRLNGPSESSEQRASLASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQ

FPVGADVPLLILRGG GPCSPTKTAKT KTDTKENSGSLETINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKP PPNTKDLDVFLRKQESGF

GFRVLGGDGPDQS IYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGE EKQPEDESHQAFSQNGSPRL

NRAELPTRSAPQEAYDVTLQRKENEGFGFVILTSKSKPPPGV VIPHKIGRVIDGSPADRCGGLKVGDHISAVNGQSIVDLSHDNIVQLIKDAGVTVTLT

VVAEEE EHHGPPSGTNSARQSPALQHRPMGQAQANHIPGDR RIALEGEIGRDVCSSYRHSWSDHKHLAQPDTAVISVVGSRHNQ - UNI7898 - S

LGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPAIKDGRIH VGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHG GLAP

SGLCSYVKPEQH AFRAFLGLSLKRLG GDWDTNSPSSSNVIYDEQPPPLPSSHSASTFEESHVPATEDSLTRVQICEKAEELKDTVQEKKSTLNGSQPE

MKYQSVHKTMSKKDPPRGSGHGEKSRLKGENGVTRRGRSASPKKSVNRHSEEHLEKIPRPLKSDPKEKSRDRSLSPRKGESKGRLTIKAGSGQDPNRKDR

GRSSSPKKQQKIGGNSLSNTEGKLSEAGSRRAAGHPRDSTEQLPDGREKSGVSRKDLKQSQPGKTRTKSPEKKSSKVDETSLPSKKTSSTAGRVVSEKEK

GKKPTAGETSRETVEHTQISAKQLKQEAQEKTALGNADDHKGRESEVTDRCRERAGCTPQSSSLVKKAPITPGPWRVPRANKVTGTTGMADKQL

For any suggestions or comments, please send an email to unitrap@crg.es