Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052572 (Dlg2)
Chromosomal location
Chr 7: 98239238 - 99597599 (+)
Description
membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2) Gene [Source:MGI (curated);Acc:Dlg2-001]
RefSeq_dna
NM_011807 
RefSeq_peptide
NP_035937.2 
UniGene
Mm.397161 Mm.466200 Mm.257035 Mm.384592 Mm.403179 Mm.408978 
MGI
MGI:1344351 
Uniprot/SWISSPROT
Q91XM9 
Uniprot/SPTREMBL
O88523 
Human Ortholog
ENSG00000150672 (DLG2)
Omim not available
UniTrap UNI35169
Vector Insertion
Chr 7: 98598426 - 98859929
Public Clones IST10722H12 (tigm) IST13330H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31534
Vector Insertion
Chr 7: 99237229 - 99275049
Public Clones IST10544F9 (tigm) IST12433F9 (tigm) IST11196A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098308
Sequence
AGAACTCTCTTCCAAGATCACTGACTTCACTAGTTCCCAAGCAGCTGGCTGTGTTTCCAGTGCCAG TTTCCTAGATTGGACTGGTAGGATGGCTCAGTG

AAGAAAGTACTGGTGCAGGAATGAGGTCCTGATTTCAAATCCCCAGAGCCCATATAGAGCCATCTGTAATCCCAGCATGTCTTCGCAGAGATGGGAGTTA

AAAGGCTGGCTACCATG GGAGCCCCGCAAGGTAGTCCTTCACAAAGGCTCCACTGGCCTGGGCTTCAACATTGTGGGCGGGGAAGATGGAGAAGGTATT

TTTGTATCCTTCATTCTGGCCGGTGGACCAGCAGACCTGAGTGGGGAGCTCCAGAGAGGAGACCAGATCTTGTCG - UNI31532 - GTGAATGGAAT

CGATCTTCGAGGAGCATCCCATGAGCAGGCAGCTGCAGCACTGAAGGGGGCTGGACAGACTGTGACAATCATAGCACAATATCAACCTGAAG ATTACGC

TCGATTTGAGGCCAAAATCCATGACCTACGAGAGCAGATGATGAACCACAGCATGAGCTCCGGGTCCGGGTCCCTTCGAACCAATCAGAAACGCTCCCTG

TATGTCAG AGCCATGTTTGACTATGACAAGAGCAAGGACAGTGGGCTGCCCAGCCAAGGACTTAGTTTTAAATATGGAGACATCCTTCATGTCATCAAT

GCCTCTGATGATGAGTGGTGGCAAGCCAGAAGGGTCACACTAGATGGGGACAGCGAGGAGATGGGCGTCATTCCCAGCAAGCGGAG GGTGGAAAGAAAG

GAGCGTGCCCGATTGAAGACAGTGAAGTTCAATGCAAAACCTGGTGTGATTGATTCCAAAGGG TCATTCAATGACAAGCGTAAAAAGAGCTTCATCTTT

TCACGAAAATTCCCATTCTACAAGAACAAGGAGCAGAGTGAGCAGGAAACCAGTGATCCTGAAC AACACGTCTCTTCTAATGCCAGCGATAGCGAAAGT

AGCTGCC GAGGACAAGAAGATCTCATTCTTTCCTATGAACCTGTCACGAGGCAGGAAA TAAACTACACGCGGCCAGTGATTATCCTGGGCCCCATGAA

GGATCGAATCAATGATGACTTGATATCTGAATTTCCTGATAAATTTGGCTCCTGTGTGCCTC ATACTACGAGGCCAAAGCGTGACTACGAAGTCGACGG

CAGAGACTATCACTTTGTCATTTCTAGAGAACAAATGGAGAAAGATATCCAAGAGCACAAATTTATAGAAGCTGGCCAGTACAATGACAATTTATACGGA

ACCAGTGTGCAATCTGTGAGATTTGTAGCAGAAAGG GGCAAGCACTGTATACTTGATGTATCAGGAAATGCTATTAAGCGGTTACAAGTCGCCCAGCTC

TATCCCATTGCCATCTTCATAAAGCCCAAGTCTCTGGAACCTCTGAT GGAGATGAATAAGCGTCTGACAGAGGAACAAGCCAAGAAAACTTATGACCGG

GCGATTAAACTAGAACAAGAATTTGGAGAATATTTTACAG CTATTGTCCAAGGAGATACCTTAGAAGATATTTACAACCAATGCAAGCTTGTTATTGAA

GAGCAGTCTGGACCTTTCATCTGGATTCCCTCAAAGGAGAAGTTATAAATTAGCTACTGCACCTCTGACAACGACAGAAGAGCATTTAGAAGAACAAAAT

ATATATAATCTAACACTTGGAGGCTTTTATGTTTTTGTTGCATTTATGTTTTTGCAGTCAATGTGAATCCTTATGAATGTACAACACAAACTGTGTGAAG

CCATGAAGGAAACAGAGGGGCCGAAGGGTGGGACGGAAAAGACATCACAGTATGCAGGAAGGCTTGGGTTTGCTCAAAGTACCAGGTATAGGGATGAACC

TCTGATGGGCTCTCTGCCCTAGAGTTGGGCAGCCTTCTCACCCCAGCAGATGTCCAGAGCTGATTTAGCTGCTGAGCTCTCTGTGTTTGCTTTAAGAAAA

GTTGCCAGCACTTGAACCTCACCAACCTACCCTTTACCCACCTCTGTAATTGGTACACTTCGAATTTTATAACTATGCACATCCTTTGATTTGCTAACAA

GCAAAGGAAATAGGGAAAACAGAAAGAAGTCCCTTTGGAGATGACATACTATCAGGGGAGGATGATTGCTTAGTTCCTTAGCTGGCATGCGCAAAGACAA

GTGTGTCCTGTGTGGAGGACTAACCTTAGAGAGGAGGAGATTCCACCTGGCCTAGCTTTATGGCTGTCAATTGTCTATTTTGCCATTTATAAGCTGAAAG

AAGGCACTAAAGATGAGAATAATTTATACAATAAATATATTAAATGTATAGAAATGAATTTCTATAGGTGAAAAAGTTTTGTGAAATATTTTGTAACGAC

TAAAAAACATTGAAAGACTAAATGTACGCACTCTCAGCAGATGATCAAATTCAAGAATTTGAGGCTGCACTCTCCCTTTTGTTGCCAATGATCCATTCAG

AGCATCTGAGTTCCCTCCAGGTCTGACAAAGACTTCCCTTTCACTCCCCTCCCACACTGCCCATGCACACTAGCACACTAGCGATACACTCTTACGGAAC

ACACTCCTGGATAAATTACCCTCATGGATAGTTTTGGAAGAGATTTTTGTTACAATTCTTTAAGCCCATGGCTTTTCAGATACAAACTCATGCAAATGAT

CGAAAGGGAAAGATTGCTTTCCTCTAGTTAAATAGCCTGAGCCAACCACTCAGATAGTCAAATAACATTGTTCCTAGTTACTTGCATACAGTTCAAGAAC

CATTCAGTATTCTGGCAAACCATAAGTCATTAGAATTATCTTTTCTTTGTTTCACAGAGCAATTGAAGTGTTTTGTAACAGCCCTAGTTGGCATTATAGG

GGGAGATCTGTCCTAAGATGCACTATTTCTCTGAGGAAGAGAAAAAAGAGAAGTTATCTAGTTGGGAGTGGTGAGGGACGCACTTTGTTTCAGTATATAG

GGCAAAGAGAACCACAAGAAAAGGACGATTTATGGCTTTGAGCTCAACCAATTGAATTGCCTTCCTTAGGGCTGCACCTGGACCAAGTTTATTTTTCTAA

CAATTATACTAATAACGATTTTAAAAGAGAAACCTCCCAAAGCCTATAAGCTGAAACACAAGAGTTAGCTTCCCATTTTAGCGCTGATGGGGTCATCAGC

CCTGGTTCTGCCCAAGGTGTTCAGAGAGAGACTTTTTAGTATTATTAATAACCACTCAAGTCTGGGTTCTATGCATGCCCAGATTAAGCCCCATCGCCTT

ATTTCTGGGGTACATCAAGACCTGGCAGGGATTCTGCCACACTGTGCAGTCAACCAGCACATAGGCTGGAGTATAAGAACAAAAGACAGAGCCATCAAAG

TGATGGGGCTTCTTCTAAGTTAGACCATCAGAGCTTAAAACTGAGAGTCTCTTTCCAAAATCAACGGTCATTCATCTTTTACTAAATAACCACCATCTGC

CCAGCTGCAGTCACCAAAAGAAATGTTAAATTACAAAAGTAAGCGTCTACCTATAGTCTTGAGGCTGCCTTTGCCAAATGAAGAGGTACCAAGCAGTCAT

ATGTAATTTTTTCCCTCGATTTTCTAGAGATAGCCTTAGAGGGCTCAAAATGCTAAAAGACGTGTCCATGTCTGCAACTCACCAGTTTCAGGTCACGGCC

AACTTCCATCAATATAGCTCTCAGAAGTTTTCTGCCACTAGAATGCCATTCCTGATCCCAGCTCTCTTTATAGGCCACCATGATAACTTCTTTGGTTTCT

CCACTGAGCATGCAACCATTTACCTTAGAGGACTGTCATTAATGAGTAGATGTTTTCTCTAGTTGTGTGATGTGCTTTCCATTTGATAGTATTGTGTGGC

TGAGTACAATCCAATTGAACCACAAACCATTGGTTTTGTAGTAATATAATTATTTATTTTCCCAGTATAGATGCTTCCGGATTAGCATTAGCACTGATTT

TTTATGTAGATTTATATAAATATAAATACATATA
Translation
 MSSQRWELKGWLPW WEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILS - UNI31532 - VNGIDLRGASHEQAAAA

LKGAGQTVTIIAQYQPED DYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVR RAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQAR

RVTLDGDSEEMGVIPSKRR RVERKERARLKTVKFNAKPGVIDSKG SFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPEQ QHVSSNASDSESSCR RG

QEDLILSYEPVTRQEI INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPH HTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGT

SVQSVRFVAER GKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLM MEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTA AIVQGDTLEDIYNQCKL

VIEEQSGPFIWIPSKEKL
Transcript ENSMUST00000074273
Sequence
AAAAGCAACTGAGGTTCTAACTTTCGGATGCTGAATCCTCGGCTAATTGAAATTACTGGGCACAATGCTATATATAGCCAATGAAGAGATTCTGAGCTCT

CACTCAGTGCCTTCAAGACATGTCGTTTTGTAGTCAGAGGAAACAGGGATCAATGCATTTTCAAACTGACAGAGGGAACGGATGCTCCTTAGCAGCACAT

GCCCAGGATCGTGTGTGTGGGGCTTGCGCTGTGCTGAGAAGCTGATCACCACCGGCCCATATGCCCCTTATTTACTGCAATGTTCTTTGCATGTTATTGT

GCACTCCGGACTAACGTAAAG AAGTATCGATACCAAGATGAGGACGGTCCACATGATCATTCCTTACCTCGGCTAACTCATGAAGTAAGAGGGCCAGAA

CTTGTGCATGTGTCGGAAAAGAACCTCTCTCAAATAGAAAATGTGCACGGATATGTCTTACAGTCTCACATCTCTCCTCTGAAG - UNI35169 - GC

TAGCCCTGCTCCTATAATTGTCAACACAGACACTTTGGACACTATTCCTTAT GTCAATGGAACAGAAATTGAATATGAATTTGAAGAAATTACATTGGA

GAGG GGAAATTCAGGTCTGGGATTCAGTATTGCTGGAGGGACAGATAATCCCCACATTGGAGATGACCCTGGCATATTTATTACGAAGATTATTCCAGG

AGGTGCTGCGGCAGAGGATGGCAGACTCAG GGTCAACGACTGTATCTTGCGGGTGAATGAAGTTGATGTGTCAGAGGTTTCCCACAGTAAAGCAGTGGA

AGCCCTCAAGGAAGCCGGCTCTATTGTGCGGCTGTACGTGCGCAGAAGGCGACCCATATTGGAGACTGTTGTGGAAATCAAACTTTTTAAAGGTCCAAAA

G GTTTAGGCTTCAGTATTGCTGGAGGGGTGGGGAACCAGCACATTCCTGGAGACAACAGCATCTATGTAACAAAAATTATAGATGGTGGAGCTGCACAG

AAAGATGGAAGGTTGCAAGTAGGAGACAGACTGCTAATG GTAAATAACTATAGTTTAGAAGAAGTTACACACGAAGAGGCTGTAGCGATATTGAAGAAC

ACATCTGATGTTGTTTATCTAAAAGTTGGCAAACCCACCACTATTTATATGACTGATCCTTATGGGCCACCGGATATTACTCACT CTTATTCTCCACCG

ATGGAAAATCATCTACTGTCTGGTAACAATGGCACATTAGAATACAAGACTTCCCTGCCGCCCATCTCTCCAGGAAGGTACTCACCAATTCCCAAGCACA

TGCTGGGTGAAGATGACTACACCAG GCCGCCGGAACCTGTTTACAGCACTGTGAATAAACTGTGTGATAAGCCTGCTTCTCCCAGGCACTATTCCCCTG

TTGAGTGTGACAAAAGCTTCCTTCTCTCAACTCCCTACCCCCACTACCACCTAGGCCTGCTCCCTGACTCTGACATGACCAG TCATTCCCAGCACAGTA

CTGCAACTCGCCAGCCTTCAGTGACTCTCCAACGGGCCATCTCCCTGGAAGG GGAGCCCCGCAAGGTAGTCCTTCACAAAGGCTCCACTGGCCTGGGCT

TCAACATTGTGGGCGGGGAAGATGGAGAAGGTATTTTTGTATCCTTCATTCTGGCCGGTGGACCAGCAGACCTGAGTGGGGAGCTCCAGAGAGGAGACCA

GATCTTGTCG - UNI31532 - GTGAATGGAATCGATCTTCGAGGAGCATCCCATGAGCAGGCAGCTGCAGCACTGAAGGGGGCTGGACAGACTGTGA

CAATCATAGCACAATATCAACCTGAAG ATTACGCTCGATTTGAGGCCAAAATCCATGACCTACGAGAGCAGATGATGAACCACAGCATGAGCTCCGGGT

CCGGGTCCCTTCGAACCAATCAGAAACGCTCCCTGTATGTCAG AGCCATGTTTGACTATGACAAGAGCAAGGACAGTGGGCTGCCCAGCCAAGGACTTA

GTTTTAAATATGGAGACATCCTTCATGTCATCAATGCCTCTGATGATGAGTGGTGGCAAGCCAGAAGGGTCACACTAGATGGGGACAGCGAGGAGATGGG

CGTCATTCCCAGCAAGCGGAG GGTGGAAAGAAAGGAGCGTGCCCGATTGAAGACAGTGAAGTTCAATGCAAAACCTGGTGTGATTGATTCCAAAGGG T

CATTCAATGACAAGCGTAAAAAGAGCTTCATCTTTTCACGAAAATTCCCATTCTACAAGAACAAGGAGCAGAGTGAGCAGGAAACCAGTGATCCTGAAC 

GAGGACAAGAAGATCTCATTCTTTCCTATGAACCTGTCACGAGGCAGGAAA TAAACTACACGCGGCCAGTGATTATCCTGGGCCCCATGAAGGATCGAA

TCAATGATGACTTGATATCTGAATTTCCTGATAAATTTGGCTCCTGTGTGCCTC ATACTACGAGGCCAAAGCGTGACTACGAAGTCGACGGCAGAGACT

ATCACTTTGTCATTTCTAGAGAACAAATGGAGAAAGATATCCAAGAGCACAAATTTATAGAAGCTGGCCAGTACAATGACAATTTATACGGAACCAGTGT

GCAATCTGTGAGATTTGTAGCAGAAAGG GGCAAGCACTGTATACTTGATGTATCAGGAAATGCTATTAAGCGGTTACAAGTCGCCCAGCTCTATCCCAT

TGCCATCTTCATAAAGCCCAAGTCTCTGGAACCTCTGAT GGAGATGAATAAGCGTCTGACAGAGGAACAAGCCAAGAAAACTTATGACCGGGCGATTAA

ACTAGAACAAGAATTTGGAGAATATTTTACAG CTATTGTCCAAGGAGATACCTTAGAAGATATTTACAACCAATGCAAGCTTGTTATTGAAGAGCAGTC

TGGACCTTTCATCTGGATTCCCTCAAAGGAGAAGTTATAAATTAGCTACTGCACCTCTGACAACGACAGAAGAGCATTTAGAAGAACAAAATATATATAA

TCTAACACTTGGAGGCTTTTATGTTTTTGTTGCATTTATGTTTTTGCAGTCAATGTGAATCCTTATGAATGTACAACACAAACTGTGTGAAGCCATGAAG

GAAACAGAGGGGCCGAAGGGTGGGACGGAAAAGACATCACAGTATGCAGGAAGGCTTGGGTTTGCTCAAAGTACCAGGTATAGGGATGAACCTCTGATGG

GCTCTCTGCCCTAGAGTTGGGCAGCCTTCTCACCCCAGCAGATGTCCAGAGCTGATTTAGCTGCTGAGCTCTCTGTGTTTGCTTTAAGAAAAGTTGCCAG

CACTTGAACCTCACCAACCTACCCTTTACCCACCTCTGTAATTGGTACACTTCGAATTTTATAACTATGCACATCCTTTGATTTGCTAACAAGCAAAGGA

AATAGGGAAAACAGAAAGAAGTCCCTTTGGAGATGACATACTATCAGGGGAGGATGATTGCTTAGTTCCTTAGCTGGCATGCGCAAAGACAAGTGTGTCC

TGTGTGGAGGACTAACCTTAGAGAGGAGGAGATTCCACCTGGCCTAGCTTTATGGCTGTCAATTGTCTATTTTGCCATTTATAAGCTGAAAGAAGGCACT

AAAGATGAGAATAATTTATACAATAAATATATTAAATGTATAGAAATGAATTTCTATAGGTGAAAAAGTTTTGTGAAATATTTTGTAACGACTAAAAAAC

ATTGAAAGACTAAATGTACGCACTCTCAGCAGATGATCAAATTCAAGAATTTGAGGCTGCACTCTCCCTTTTGTTGCCAATGATCCATTCAGAGCATCTG

AGTTCCCTCCAGGTCTGACAAAGACTTCCCTTTCACTCCCCTCCCACACTGCCCATGCACACTAGCACACTAGCGATACACTCTTACGGAACACACTCCT

GGATAAATTACCCTCATGGATAGTTTTGGAAGAGATTTTTGTTACAATTCTTTAAGCCCATGGCTTTTCAGATACAAACTCATGCAAATGATCGAAAGGG

AAAGATTGCTTTCCTCTAGTTAAATAGCCTGAGCCAACCACTCAGATAGTCAAATAACATTGTTCCTAGTTACTTGCATACAGTTCAAGAACCATTCAGT

ATTCTGGCAAACCATAAGTCATTAGAATTATCTTTTCTTTGTTTCACAGAGCAATTGAAGTGTTTTGTAACAGCCCTAGTTGGCATTATAGGGGGAGATC

TGTCCTAAGATGCACTATTTCTCTGAGGAAGAGAAAAAAGAGAAGTTATCTAGTTGGGAGTGGTGAGGGACGCACTTTGTTTCAGTATATAGGGCAAAGA

GAACCACAAGAAAAGGACGATTTATGGCTTTGAGCTCAACCAATTGAATTGCCTTCCTTAGGGCTGCACCTGGACCAAGTTTATTTTTCTAACAATTATA

CTAATAACGATTTTAAAAGAGAAACCTCCCAAAGCCTATAAGCTGAAACACAAGAGTTAGCTTCCCATTTTAGCGCTGATGGGGTCATCAGCCCTGGTTC

TGCCCAAGGTGTTCAGAGAGAGACTTTTTAGTATTATTAATAACCACTCAAGTCTGGGTTCTATGCATGCCCAGATTAAGCCCCATCGCCTTATTTCTGG

GGTACATCAAGACCTGGCAGGGATTCTGCCACACTGTGCAGTCAACCAGCACATAGGCTGGAGTATAAGAACAAAAGACAGAGCCATCAAAGTGATGGGG

CTTCTTCTAAGTTAGACCATCAGAGCTTAAAACTGAGAGTCTCTTTCCAAAATCAACGGTCATTCATCTTTTACTAAATAACCACCATCTGCCCAGCTGC

AGTCACCAAAAGAAATGTTAAATTACAAAAGTAAGCGTCTACCTATAGTCTTGAGGCTGCCTTTGCCAAATGAAGAGGTACCAAGCAGTCATATGTAATT

TTTTCCCTCGATTTTCTAGAGATAGCCTTAGAGGGCTCAAAATGCTAAAAGACGTGTCCATGTCTGCAACTCACCAGTTTCAGGTCACGGCCAACTTCCA

TCAATATAGCTCTCAGAAGTTTTCTGCCACTAGAATGCCATTCCTGATCCCAGCTCTCTTTATAGGCCACCATGATAACTTCTTTGGTTTCTCCACTGAG

CATGCAACCATTTACCTTAGAGGACTGTCATTAATGAGTAGATGTTTTCTCTAGTTGTGTGATGTGCTTTCCATTTGATAGTATTGTGTGGCTGAGTACA

ATCCAATTGAACCACAAACCATTGGTTTTGTAGTAATATAATTATTTATTTTCCCAGTATAGATGCTTCCGGATTAGCATTAGCACTGATTTTTTATGTA

GATTTATATAAATATAAATACATATA
Translation
MFFACYCALRTNVK KYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLK - UNI35169 - ASPAPIIVNTDTLDTIP

Y VNGTEIEYEFEEITLER GNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLR RVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYV

RRRRPILETVVEIKLFKGPKG GLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLM VNNYSLEEVTHEEAVAILKNTSDVVYLKVGK

PTTIYMTDPYGPPDITHS SYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLGEDDYTR RPPEPVYSTVNKLCDKPASPRHYSPVECDKSFL

LSTPYPHYHLGLLPDSDMTS SHSQHSTATRQPSVTLQRAISLEG GEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILS 

- UNI31532 - VNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPED DYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVR RAMFDYDKSKD

SGLPSQGLSFKYGDILHVINASDDEWWQARRVTLDGDSEEMGVIPSKRR RVERKERARLKTVKFNAKPGVIDSKG SFNDKRKKSFIFSRKFPFYKNKE

QSEQETSDPER RGQEDLILSYEPVTRQEI INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPH HTTRPKRDYEVDGRDYHFVISREQMEKDIQEHK

FIEAGQYNDNLYGTSVQSVRFVAER GKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLM MEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTA AIV

QGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
Transcript ENSMUST00000107193
Sequence
ATATGAAGACAGGGGAACACTGATGCGATTGCTTCTTGTTTTTTACGAGTGTGGGAATCAAAATACTTCCCAATGAAAACATCTGCCTTTGTGCAAGTCA

CGCCCAGTTATCCCCCCAAAGAAATGCTCTGATTAACTTTTTTTAAAGTCTTAAGATAGCAGTTTGTGTAGCCGATCTAATTAAGAAGTTTATGTAACAG

ATCTGCAGGTTTTTTTTTTTTTCCTTCTTCAACTGGGTTCTTTGAGCTCAGTTTGAATGTTACCGACTTTCGATATGCAACGGCCAAGTGCTTCCCGAGC

TGAGAATTATCAGCTTCTGTGGGATACAATTGCTTCTTTAAAACAATGTGAAGAAGCTATGCAACACGCGTTCATTCCG GTCAATGGAACAGAAATTGA

ATATGAATTTGAAGAAATTACATTGGAGAGG GGAAATTCAGGTCTGGGATTCAGTATTGCTGGAGGGACAGATAATCCCCACATTGGAGATGACCCTGG

CATATTTATTACGAAGATTATTCCAGGAGGTGCTGCGGCAGAGGATGGCAGACTCAG GGTCAACGACTGTATCTTGCGGGTGAATGAAGTTGATGTGTC

AGAGGTTTCCCACAGTAAAGCAGTGGAAGCCCTCAAGGAAGCCGGCTCTATTGTGCGGCTGTACGTGCGCAGAAGGCGACCCATATTGGAGACTGTTGTG

GAAATCAAACTTTTTAAAGGTCCAAAAG GTTTAGGCTTCAGTATTGCTGGAGGGGTGGGGAACCAGCACATTCCTGGAGACAACAGCATCTATGTAACA

AAAATTATAGATGGTGGAGCTGCACAGAAAGATGGAAGGTTGCAAGTAGGAGACAGACTGCTAATG GTAAATAACTATAGTTTAGAAGAAGTTACACAC

GAAGAGGCTGTAGCGATATTGAAGAACACATCTGATGTTGTTTATCTAAAAGTTGGCAAACCCACCACTATTTATATGACTGATCCTTATGGGCCACCGG

ATATTACTCACT CTTATTCTCCACCGATGGAAAATCATCTACTGTCTGGTAACAATGGCACATTAGAATACAAGACTTCCCTGCCGCCCATCTCTCCAG

GAAGGTACTCACCAATTCCCAAGCACATGCTGGGTGAAGATGACTACACCAG TCATTCCCAGCACAGTACTGCAACTCGCCAGCCTTCAGTGACTCTCC

AACGGGCCATCTCCCTGGAAGG GGAGCCCCGCAAGGTAGTCCTTCACAAAGGCTCCACTGGCCTGGGCTTCAACATTGTGGGCGGGGAAGATGGAGAAG

GTATTTTTGTATCCTTCATTCTGGCCGGTGGACCAGCAGACCTGAGTGGGGAGCTCCAGAGAGGAGACCAGATCTTGTCG - UNI31532 - GTGAAT

GGAATCGATCTTCGAGGAGCATCCCATGAGCAGGCAGCTGCAGCACTGAAGGGGGCTGGACAGACTGTGACAATCATAGCACAATATCAACCTGAAG AT

TACGCTCGATTTGAGGCCAAAATCCATGACCTACGAGAGCAGATGATGAACCACAGCATGAGCTCCGGGTCCGGGTCCCTTCGAACCAATCAGAAACGCT

CCCTGTATGTCAG AGCCATGTTTGACTATGACAAGAGCAAGGACAGTGGGCTGCCCAGCCAAGGACTTAGTTTTAAATATGGAGACATCCTTCATGTCA

TCAATGCCTCTGATGATGAGTGGTGGCAAGCCAGAAGGGTCACACTAGATGGGGACAGCGAGGAGATGGGCGTCATTCCCAGCAAGCGGAG GGTGGAAA

GAAAGGAGCGTGCCCGATTGAAGACAGTGAAGTTCAATGCAAAACCTGGTGTGATTGATTCCAAAGGG GACATCCCCGGATTAGGTGACGACGGTTATG

GAACAAAGACTCTGA GAGGACAAGAAGATCTCATTCTTTCCTATGAACCTGTCACGAGGCAGGAAA TAAACTACACGCGGCCAGTGATTATCCTGGGC

CCCATGAAGGATCGAATCAATGATGACTTGATATCTGAATTTCCTGATAAATTTGGCTCCTGTGTGCCTC ATACTACGAGGCCAAAGCGTGACTACGAA

GTCGACGGCAGAGACTATCACTTTGTCATTTCTAGAGAACAAATGGAGAAAGATATCCAAGAGCACAAATTTATAGAAGCTGGCCAGTACAATGACAATT

TATACGGAACCAGTGTGCAATCTGTGAGATTTGTAGCAGAAAGG GGCAAGCACTGTATACTTGATGTATCAGGAAATGCTATTAAGCGGTTACAAGTCG

CCCAGCTCTATCCCATTGCCATCTTCATAAAGCCCAAGTCTCTGGAACCTCTGAT GGAGATGAATAAGCGTCTGACAGAGGAACAAGCCAAGAAAACTT

ATGACCGGGCGATTAAACTAGAACAAGAATTTGGAGAATATTTTACAG CTATTGTCCAAGGAGATACCTTAGAAGATATTTACAACCAATGCAAGCTTG

TTATTGAAGAGCAGTCTGGACCTTTCATCTGGATTCCCTCAAAGGAGAAGTTATAAATTAGCTACTGCACCTCTGACAACGACAGAAGAGCATTTAGAAG

AACAAAATATATATAATCTAACACTTGGAGGCTTTTATGTTTTTGTTGCATTTATGTTTTTGCAGTCAATGTGAATCCTTATGAATGTACAACACAAACT

GTGTGAAGCCATGAAGGAAACAGAGGGGCCGAAGGGTGGGACGGAAAAGACATCACAGTATGCAGGAAGGCTTGGGTTTGCTCAAAGTACCAGGTATAGG

GATGAACCTCTGATGGGCTCTCTGCCCTAGAGTTGGGCAGCCTTCTCACCCCAGCAGATGTCCAGAGCTGATTTAGCTGCTGAGCTCTCTGTGTTTGCTT

TAAGAAAAGTTGCCAGCACTTGAACCTCACCAACCTACCCTTTACCCACCTCTGTAATTGGTACACTTCGAATTTTATAACTATGCACATCCTTTGATTT

GCTAACAAGCAAAGGAAATAGGGAAAACAGAAAGAAGTCCCTTTGGAGATGACATACTATCAGGGGAGGATGATTGCTTAGTTCCTTAGCTGGCATGCGC

AAAGACAAGTGTGTCCTGTGTGGAGGACTAACCTTAGAGAGGAGGAGATTCCACCTGGCCTAGCTTTATGGCTGTCAATTGTCTATTTTGCCATTTATAA

GCTGAAAGAAGGCACTAAAGATGAGAATAATTTATACAATAAATATATTAAATGTATAGAAATGAATTTCTATAGGTGAAAAAGTTTTGTGAAATATTTT

GTAACGACTAAAAAACATTGAAAGACTAAATGTACGCACTCTCAGCAGATGATCAAATTCAAGAATTTGAGGCTGCACTCTCCCTTTTGTTGCCAATGAT

CCATTCAGAGCATCTGAGTTCCCTCCAGGTCTGACAAAGACTTCCCTTTCACTCCCCTCCCACACTGCCCATGCACACTAGCACACTAGCGATACACTCT

TACGGAACACACTCCTGGATAAATTACCCTCATGGATAGTTTTGGAAGAGATTTTTGTTACAATTCTTTAAGCCCATGGCTTTTCAGATACAAACTCATG

CAAATGATCGAAAGGGAAAGATTGCTTTCCTCTAGTTAAATAGCCTGAGCCAACCACTCAGATAGTCAAATAACATTGTTCCTAGTTACTTGCATACAGT

TCAAGAACCATTCAGTATTCTGGCAAACCATAAGTCATTAGAATTATCTTTTCTTTGTTTCACAGAGCAATTGAAGTGTTTTGTAACAGCCCTAGTTGGC

ATTATAGGGGGAGATCTGTCCTAAGATGCACTATTTCTCTGAGGAAGAGAAAAAAGAGAAGTTATCTAGTTGGGAGTGGTGAGGGACGCACTTTGTTTCA

GTATATAGGGCAAAGAGAACCACAAGAAAAGGACGATTTATGGCTTTGAGCTCAACCAATTGAATTGCCTTCCTTAGGGCTGCACCTGGACCAAGTTTAT

TTTTCTAACAATTATACTAATAACGATTTTAAAAGAGAAACCTCCCAAAGCCTATAAGCTGAAACACAAGAGTTAGCTTCCCATTTTAGCGCTGATGGGG

TCATCAGCCCTGGTTCTGCCCAAGGTGTTCAGAGAGAGACTTTTTAGTATTATTAATAACCACTCAAGTCTGGGTTCTATGCATGCCCAGATTAAGCCCC

ATCGCCTTATTTCTGGGGTACATCAAGACCTGGCAGGGATTCTGCCACACTGTGCAGTCAACCAGCACATAGGCTGGAGTATAAGAACAAAAGACAGAGC

CATCAAAGTGATGGGGCTTCTTCTAAGTTAGACCATCAGAGCTTAAAACTGAGAGTCTCTTTCCAAAATCAACGGTCATTCATCTTTTACTAAATAACCA

CCATCTGCCCAGCTGCAGTCACCAAAAGAAATGTTAAATTACAAAAGTAAGCGTCTACCTATAGTCTTGAGGCTGCCTTTGCCAAATGAAGAGGTACCAA

GCAGTCATATGTAATTTTTTCCCTCGATTTTCTAGAGATAGCCTTAGAGGGCTCAAAATGCTAAAAGACGTGTCCATGTCTGCAACTCACCAGTTTCAGG

TCACGGCCAACTTCCATCAATATAGCTCTCAGAAGTTTTCTGCCACTAGAATGCCATTCCTGATCCCAGCTCTCTTTATAGGCCACCATGATAACTTCTT

TGGTTTCTCCACTGAGCATGCAACCATTTACCTTAGAGGACTGTCATTAATGAGTAGATGTTTTCTCTAGTTGTGTGATGTGCTTTCCATTTGATAGTAT

TGTGTGGCTGAGTACAATCCAATTGAACCACAAACCATTGGTTTTGTAGTAATATAATTATTTATTTTCCCAGTATAGATGCTTCCGGATTAGCATTAGC

ACTGATTTTTTATGTAGATTTATATAAATATAAATACATATA
Translation
MLPTFDMQRPSASRAENYQLLWDTIASLKQCEEAMQHAFIP VNGTEIEYEFEEITLER GNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGR

LR RVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKG GLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRL

QVGDRLLM VNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHS SYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLG

EDDYTS SHSQHSTATRQPSVTLQRAISLEG GEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILS - UNI31532 - V

NGIDLRGASHEQAAAALKGAGQTVTIIAQYQPED DYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVR RAMFDYDKSKDSGLPSQGLSFKYGD

ILHVINASDDEWWQARRVTLDGDSEEMGVIPSKRR RVERKERARLKTVKFNAKPGVIDSKG DIPGLGDDGYGTKTLR RGQEDLILSYEPVTRQEI I

NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPH HTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAER GKHCIL

DVSGNAIKRLQVAQLYPIAIFIKPKSLEPLM MEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTA AIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL

Transcript ENSMUST00000107196
Sequence
ATGTTCTTTGCATGTTATTGTGCACTCCGGACTAACGTAAAG AAGTATCGATACCAAGATGAGGACGGTCCACATGATCATTCCTTACCTCGGCTAACT

CATGAAGTAAGAGGGCCAGAACTTGTGCATGTGTCGGAAAAGAACCTCTCTCAAATAGAAAATGTGCACGGATATGTCTTACAGTCTCACATCTCTCCTC

TGAAG - UNI35169 - GCTAGCCCTGCTCCTATAATTGTCAACACAGACACTTTGGACACTATTCCTTAT GTCAATGGAACAGAAATTGAATATGA

ATTTGAAGAAATTACATTGGAGAGG GGAAATTCAGGTCTGGGATTCAGTATTGCTGGAGGGACAGATAATCCCCACATTGGAGATGACCCTGGCATATT

TATTACGAAGATTATTCCAGGAGGTGCTGCGGCAGAGGATGGCAGACTCAG GGTCAACGACTGTATCTTGCGGGTGAATGAAGTTGATGTGTCAGAGGT

TTCCCACAGTAAAGCAGTGGAAGCCCTCAAGGAAGCCGGCTCTATTGTGCGGCTGTACGTGCGCAGAAGGCGACCCATATTGGAGACTGTTGTGGAAATC

AAACTTTTTAAAGGTCCAAAAG GTTTAGGCTTCAGTATTGCTGGAGGGGTGGGGAACCAGCACATTCCTGGAGACAACAGCATCTATGTAACAAAAATT

ATAGATGGTGGAGCTGCACAGAAAGATGGAAGGTTGCAAGTAGGAGACAGACTGCTAATG GTAAATAACTATAGTTTAGAAGAAGTTACACACGAAGAG

GCTGTAGCGATATTGAAGAACACATCTGATGTTGTTTATCTAAAAGTTGGCAAACCCACCACTATTTATATGACTGATCCTTATGGGCCACCGGATATTA

CTCACT CTTATTCTCCACCGATGGAAAATCATCTACTGTCTGGTAACAATGGCACATTAGAATACAAGACTTCCCTGCCGCCCATCTCTCCAGGAAGGT

ACTCACCAATTCCCAAGCACATGCTGGGTGAAGATGACTACACCAG GCCGCCGGAACCTGTTTACAGCACTGTGAATAAACTGTGTGATAAGCCTGCTT

CTCCCAGGCACTATTCCCCTGTTGAGTGTGACAAAAGCTTCCTTCTCTCAACTCCCTACCCCCACTACCACCTAGGCCTGCTCCCTGACTCTGACATGAC

CAG TCATTCCCAGCACAGTACTGCAACTCGCCAGCCTTCAGTGACTCTCCAACGGGCCATCTCCCTGGAAGG GGAGCCCCGCAAGGTAGTCCTTCACA

AAGGCTCCACTGGCCTGGGCTTCAACATTGTGGGCGGGGAAGATGGAGAAGGTATTTTTGTATCCTTCATTCTGGCCGGTGGACCAGCAGACCTGAGTGG

GGAGCTCCAGAGAGGAGACCAGATCTTGTCG - UNI31532 - GTGAATGGAATCGATCTTCGAGGAGCATCCCATGAGCAGGCAGCTGCAGCACTGA

AGGGGGCTGGACAGACTGTGACAATCATAGCACAATATCAACCTGAAG ATTACGCTCGATTTGAGGCCAAAATCCATGACCTACGAGAGCAGATGATGA

ACCACAGCATGAGCTCCGGGTCCGGGTCCCTTCGAACCAATCAGAAACGCTCCCTGTATGTCAG AGCCATGTTTGACTATGACAAGAGCAAGGACAGTG

GGCTGCCCAGCCAAGGACTTAGTTTTAAATATGGAGACATCCTTCATGTCATCAATGCCTCTGATGATGAGTGGTGGCAAGCCAGAAGGGTCACACTAGA

TGGGGACAGCGAGGAGATGGGCGTCATTCCCAGCAAGCGGAG GGTGGAAAGAAAGGAGCGTGCCCGATTGAAGACAGTGAAGTTCAATGCAAAACCTGG

TGTGATTGATTCCAAAGGG GACATCCCCGGATTAGGTGACGACGGTTATGGAACAAAGACTCTGA GAGGACAAGAAGATCTCATTCTTTCCTATGAAC

CTGTCACGAGGCAGGAAA TAAACTACACGCGGCCAGTGATTATCCTGGGCCCCATGAAGGATCGAATCAATGATGACTTGATATCTGAATTTCCTGATA

AATTTGGCTCCTGTGTGCCTC ATACTACGAGGCCAAAGCGTGACTACGAAGTCGACGGCAGAGACTATCACTTTGTCATTTCTAGAGAACAAATGGAGA

AAGATATCCAAGAGCACAAATTTATAGAAGCTGGCCAGTACAATGACAATTTATACGGAACCAGTGTGCAATCTGTGAGATTTGTAGCAGAAAGG GGCA

AGCACTGTATACTTGATGTATCAGGAAATGCTATTAAGCGGTTACAAGTCGCCCAGCTCTATCCCATTGCCATCTTCATAAAGCCCAAGTCTCTGGAACC

TCTGAT GGAGATGAATAAGCGTCTGACAGAGGAACAAGCCAAGAAAACTTATGACCGGGCGATTAAACTAGAACAAGAATTTGGAGAATATTTTACAG 

CTATTGTCCAAGGAGATACCTTAGAAGATATTTACAACCAATGCAAGCTTGTTATTGAAGAGCAGTCTGGACCTTTCATCTGGATTCCCTCAAAGGAGAA

GTTATAAATTAGCTACTGCACCTCTGACAACGACAGAAGAGCATTTAGAAGAACAAAATATATATAATCTAACACTTGGAGGCTTTTATGTTTTTGTTGC

ATTTATGTTTTTGCAGTCAATGTGAATCCTTATGAATGTACAACACAAACTGTGTGAAGCCATGAAGGAAACAGAGGGGCCGAAGGGTGGGACGGAAAAG

ACATCACAGTATGCAGGAAGGCTTGGGTTTGCTCAAAGTACCAGGTATAGGGATGAACCTCTGATGGGCTCTCTGCCCTAGAGTTGGGCAGCCTTCTCAC

CCCAGCAGATGTCCAGAGCTGATTTAGCTGCTGAGCTCTCTGTGTTTGCTTTAAGAAAAGTTGCCAGCACTTGAACCTCACCAACCTACCCTTTACCCAC

CTCTGTAATTGGTACACTTCGAATTTTATAACTATGCACATCCTTTGATTTGCTAACAAGCAAAGGAAATAGGGAAAACAGAAAGAAGTCCCTTTGGAGA

TGACATACTATCAGGGGAGGATGATTGCTTAGTTCCTTAGCTGGCATGCGCAAAGACAAGTGTGTCCTGTGTGGAGGACTAACCTTAGAGAGGAGGAGAT

TCCACCTGGCCTAGCTTTATGGCTGTCAATTGTCTATTTTGCCATTTATAAGCTGAAAGAAGGCACTAAAGATGAGAATAATTTATACAATAAATATATT

AAATGTATAGAAATGAATTTCTATAGGTGAAAAAGTTTTGTGAAATATTTTGTAACGACTAAAAAACATTGAAAGACTAAATGTACGCACTCTCAGCAGA

TGATCAAATTCAAGAATTTGAGGCTGCACTCTCCCTTTTGTTGCCAATGATCCATTCAGAGCATCTGAGTTCCCTCCAGGTCTGACAAAGACTTCCCTTT

CACTCCCCTCCCACACTGCCCATGCACACTAGCACACTAGCGATACACTCTTACGGAACACACTCCTGGATAAATTACCCTCATGGATAGTTTTGGAAGA

GATTTTTGTTACAATTCTTTAAGCCCATGGCTTTTCAGATACAAACTCATGCAAATGATCGAAAGGGAAAGATTGCTTTCCTCTAGTTAAATAGCCTGAG

CCAACCACTCAGATAGTCAAATAACATTGTTCCTAGTTACTTGCATACAGTTCAAGAACCATTCAGTATTCTGGCAAACCATAAGTCATTAGAATTATCT

TTTCTTTGTTTCACAGAGCAATTGAAGTGTTTTGTAACAGCCCTAGTTGGCATTATAGGGGGAGATCTGTCCTAAGATGCACTATTTCTCTGAGGAAGAG

AAAAAAGAGAAGTTATCTAGTTGGGAGTGGTGAGGGACGCACTTTGTTTCAGTATATAGGGCAAAGAGAACCACAAGAAAAGGACGATTTATGGCTTTGA

GCTCAACCAATTGAATTGCCTTCCTTAGGGCTGCACCTGGACCAAGTTTATTTTTCTAACAATTATACTAATAACGATTTTAAAAGAGAAACCTCCCAAA

GCCTATAAGCTGAAACACAAGAGTTAGCTTCCCATTTTAGCGCTGATGGGGTCATCAGCCCTGGTTCTGCCCAAGGTGTTCAGAGAGAGACTTTTTAGTA

TTATTAATAACCACTCAAGTCTGGGTTCTATGCATGCCCAGATTAAGCCCCATCGCCTTATTTCTGGGGTACATCAAGACCTGGCAGGGATTCTGCCACA

CTGTGCAGTCAACCAGCACATAGGCTGGAGTATAAGAACAAAAGACAGAGCCATCAAAGTGATGGGGCTTCTTCTAAGTTAGACCATCAGAGCTTAAAAC

TGAGAGTCTCTTTCCAAAATCAACGGTCATTCATCTTTTACTAAATAACCACCATCTGCCCAGCTGCAGTCACCAAAAGAAATGTTAAATTACAAAAGTA

AGCGTCTACCTATAGTCTTGAGGCTGCCTTTGCCAAATGAAGAGGTACCAAGCAGTCATATGTAATTTTTTCCCTCGATTTTCTAGAGATAGCCTTAGAG

GGCTCAAAATGCTAAAAGACGTGTCCATGTCTGCAACTCACCAGTTTCAGGTCACGGCCAACTTCCATCAATATAGCTCTCAGAAGTTTTCTGCCACTAG

AATGCCATTCCTGATCCCAGCTCTCTTTATAGGCCACCATGATAACTTCTTTGGTTTCTCCACTGAGCATGCAACCATTTACCTTAGAGGACTGTCATTA

ATGAGTAGATGTTTTCTCTAGTTGTGTGATGTGCTTTCCATTTGATAGTATTGTGTGGCTGAGTACAATCCAATTGAACCACAAACCATTGGTTTTGTAG

TAATATAATTATTTATTTTCCCAGTATAGATGCTTCCGGATTAGCATTAGCACTGATTTTTTATGTAGATTTATATAAATATAAATACATATATATTTGC

TTGACGAATCACCAAGCACATTGGTGAGAGGGTCTTTTCCTATAGAATTCACTCATCCGTTTTGTTGTGTTGTCCTGAGCTTCCCAATGTTGAGGTCTCT

ATGGCTCCAAAGAACTGGTGTATTTTGCAGCAAATCCAATGGCATATGTGGAAATGGCATGAGAGTCACCCAGATCACATCTGGTGCAAATGCACCTGGA

GCCTCGGGCCAGACTGGTGCTAACACTGCAAACTTTGTCCGGAGCTCTCTCCAATCTGAAGGCTCGCTGGGGGCACAGTGTCACCTTCACATGCTGGGCC

CTTTCGGAAAAGTGCCAGATCGTGTCACTGGTGCTATTTTTCATGCTCTGGTACAATGTGTAGCACCATGGGGGTCTCAGCTTTACCAAAACCGAAATCC

CACCTGTCAGTCAGTTATTGCTGAGGCATTTGCTTATTGCTCTTTTCCATGAGATATGATGGCCTATTCTTAGAAGGCCCTTTCTCCCAGACCCAAATTC

AGGGGTTGGCTCTATCCATTTTGCAAGCCCATCTAGATGAAGCTGCACTCGGGTGCCTCTGTGAGCTGTCTTAGACCCTACTGCCAGCCCTTCAGGACGG

AGTCAGCGGATGCTCTGTACACCTCTGGCTCTCATCTGTTTCTCCTCATTTCTCCCACTCATCTCCTCTCATCACCTGTCATTTTGACCCTCTCTTATCC

TTCCTGGGTTTTTTAACCTGCCCCTCTTCTCTCCTATGTCTTTCTCTATCCATCTCCCCCTTCTCCATCTCCCATTCCCCTTATTAGTCCTTCCTCCCAG

ACATGACCACCCTCTTCTCTCCTCTCACATAGTTCTGATCATCAGTACATCCCGCTCCTAAGTTTCCTTGTCCTATAAAGGGCTCACGGCTGATTCAGAC

AGCAAGTCCATACGATGGACTCATGACACAAATACTTGGGGTCACCATTTTACTCACTCAGCCCAGAAAGCAAAGCTGAGTGTGAGGCCCTGCCCTGGAG

CCAGCCTGCACCACTGCCCCGGCAGTGCTGATGCAAGAGCTGTGGGCCCCCTGGCACCTGGAAGCCTCCGCCTGGACCTTCTCCAGGAACTCACTCCCAG

CACCGCCCAGGCTGAGGATGCTTCCTTTCAACAGAGGCAAACTCTGGCCCCAACAATTCTAACGAACCTCACTGAAGCCATGACACCGCCCTGATTTGGA

GAGAGATTTTTCCCCCTCTATATTCTTCTTCCCGTTTCCATGTGAAGCCCCTCTGCTTTTCAGCTGGTGATTGCTCTGGTGAGACTGAATGGACTTGCTA

GTGAAATGACATCTTTTTTTTCTGTCTTGGTCCTGCCTAAAATTCCTACACAAAAGCATTTAAGTCAAGGACTAAGGCTAAATTTATTATCCTAATGAGT

CACTCCTGGGGAGACATCAGTTCCCTTAAAGCATGTGGAGTTCCTCCTGTGACAACTGATTTTCCAGGAAACTCCATAGAGAATTCTGTGGATATGCATT

AATTATTTAAGGGTATGATATATATGGTATGCATACCATGTATACACATTACCTGAGGTCAGAGTCAATGTTGGAAACACATACACACTTCAGTCTGTAA

ATATTCTTCCTCACTGAAACCTGTGCTTCAGAAACCATTTCTCGTACAGCTGTGCAGTTTCTTGTAGCAGCTGAAGACAAGCTAAGGCAGGCAGCGAATT

TAGACTGAGATCAGCTGAAAGAGTACAGTTTCTCCCTTGCAGCTCACAAGGACAGACAGCTAAGTGGCAAGGTTGACTCCCAATGGGATGGCAAACTTTT

CTTCTTTTCAAATTTGTGTTTCCTAAGTGTATCTTAACTTCTGAGTGCACCAGGTTGTACCCATTAGATCCTTTTACTATGACAATTTTGTGCTTCTCTC

TGACAGGATGTTTCTCCAGCAAGCTGTAACGCAGGATGGGAGGGGAGGGAGGGGGAATTACTCCTTGCCTGGCTGGAGTTTACAGAGGCACTGCACAGCT

TACACTCCTGTTAAGTGTAAATATTCAACACTTCCATTCCATTTGTGTAAAAAAATAAAGCACACACGATTATAAAATC
Translation
MFFACYCALRTNVK KYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLK - UNI35169 - ASPAPIIVNTDTLDTIP

Y VNGTEIEYEFEEITLER GNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLR RVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYV

RRRRPILETVVEIKLFKGPKG GLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLM VNNYSLEEVTHEEAVAILKNTSDVVYLKVGK

PTTIYMTDPYGPPDITHS SYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLGEDDYTR RPPEPVYSTVNKLCDKPASPRHYSPVECDKSFL

LSTPYPHYHLGLLPDSDMTS SHSQHSTATRQPSVTLQRAISLEG GEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILS 

- UNI31532 - VNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPED DYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVR RAMFDYDKSKD

SGLPSQGLSFKYGDILHVINASDDEWWQARRVTLDGDSEEMGVIPSKRR RVERKERARLKTVKFNAKPGVIDSKG DIPGLGDDGYGTKTLR RGQEDL

ILSYEPVTRQEI INYTRPVIILGPMKDRINDDLISEFPDKFGSCVPH HTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQS

VRFVAER GKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLM MEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTA AIVQGDTLEDIYNQCKLVIEE

QSGPFIWIPSKEKL

For any suggestions or comments, please send an email to unitrap@crg.es