Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052676 (Zmat1)
Chromosomal location
Chr X: 131505914 - 131559831 (-)
Description
zinc finger, matrin type 1 Gene [Source:MGI (curated);Acc:Zmat1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI34999
Vector Insertion
Chr X: 131543449 - 131559832
Public Clones IST14203B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113185
Sequence
ATTGTGCGCGCCAGGCTGCGACGGCGGCGGCGGCGGTGGCGTCGCCGAAAGCTGTAGCTCAGCTGGCGAGGTCTTCCCACCCTCGGGAAGTTCCCTAAGC

TGTCGCCTCCGCCGCCGCCTACGCGGCGGCAGCGGCGGCGGCCTTGCTGGTGCCTCCCTCCTCTGCCACCTCCACCCCTGCCTGCTCACTTGCCGGTGCT

GTGGAGAAGGCGGCGGCGGCTTTGGCGGCTCCACTATGGCGGCGGCGGGGAGGGGGGACAGTAGTTTTAAAGTAGACACCTGCCCTTGCCTCAGAGAAG 

- UNI34999 - ATCCCACGTGTGATGGACAAGAACAACCTGCGTATTTTACAGATAATTTTTGTAAACCATGTGGAGTGGTTCTACAGCATGAATCAG

AAAGGATTTCACATTTTGAG GTGTGCTCGAGTGGAGAAGTCAACAGAAACAACTTTACTGATCTGCACAACATGAGTTTTGACTCCCTAGCTGCTGCTC

CATCTCACTATGTGGGAAAGAGCCATTCTCCGACTCAGAACCAGTCACTGGAAGAACATGATCAAGTATCTCCATCCACATGCTCACCAAAGATGG ATG

AACCCAATACTACTCCTGCACCTCCACCCTTCCTGAAGTCTGTTATTGTGAAGCCTCCTCCAG CATATAGAATGAGAACCTACGTATGCCATATCTGCA

GTATCACCTTTACATCTTTACATATGTTCCGGTCCCACATGCAAGGAACTGAACATCAAATTAA AGAATCTCATGTTATCAATCAAGTGAAGAATTCAA

AGAAAATGCAAGAGTCTTGTCAAGCTGAGTGTGGAGATGACATCAAAATGAAGAAATCTAGAGAACTAGAGCCCAAGGGTCATTTCAGGGAAATGGAGGA

TAATTACATGGAAGCCCAAGCCCATGAATACAGAGAAATGGTTGATTCTAGACCCAGACATAAAATGCTTGAACAAACACTTCCACTTGAAAATTTCTGG

GCACACCCAGGACCATACAATGATTCTAGAGCACTAGAAGAGCAGTTACCTCACAATTTACCAGCAGAGTCAAAGACATATGACTCTTTCCAAGATGAAC

TTGAAGATTACATCAAAGGGCAGAAGGCCAGAGGACTTGATCCCAATACTAGTTTTAGACGGATGTCAGAAAGCTATAGGTATAGGGATCAGAGATACAG

AGAAAGGGTTGATTCTGAACACAGACAGAGGCCTTGTGAGGAAAGATTTTCATTTGAGGCTCCACAGACCTACCAGCAAGAATACAGTGCCTCCCCAGTG

GAGGGCCAATCTCCTCACTGGTTACCATCTCATTCAAAGAGGAGAAATGATGATTTCCAAAATGAATTTGATGATTACAACAAGGTGCAGGAATCTAGAG

AATCCGAGCCAAAGACTTCTTTTAGAAGAATGGATAGCTCTTTTGAAACCCATAATTACGAAGAAATGGTTGACAGAAGATCCAGTCATACAATGTTTGA

GGAAGGACTCCCATGTGAGACTTTCCAGACTTACACAGATCCATACAGCAGTGCACAAGCAGTAGAAAACACGTTACCTCATTGCTTACCAGCTTATGAA

AACCAACCGAGCCTAGATGCTGAAAGCCACTATCAGCTTACCACAGAGGAGTTCTCAGAAATGCCTGCTTCTCTGAGCCTCAGTCAACAAGAAGATAACC

CTAGCTCATACAATGTAGACTATGACATTTACAAGCATCTGCCCTCAAATGACAATGCCAGTGCCCATGAAACAAGTCATAGAAGGCGACGTCAGAAGAG

AAAACGACACCTGGAGGAAGGAAAAGAAAGACCAGAGAAGGAACAGTCCAAACATAAAAGAAAAAGAAGCTATCAGGATAAAGATTTAGACAAAGACAAG

CTCATCAAGCAAAGTAAGAGAGAGGAAGATAAAGCTGGAGTCAGCTCTGAAAAAACCAAGCATCGAAGAAAGAAAAGAAAACATGAAACATCCTCAGAGA

AAGAAGAACGTAAGCACAAAAAAGAGAAAAAGAAATCTGTTGAAGAGAGAACAGAAGAGGAAATCCTTTGGGATGAGTCAATTCTTGGGTTCTGACCCTA

TGGTATACCAAGAAGGGCTAAAAGAAAATGATACTGATTTAGATACACACAGGAATAAGAGGAGAAACCAAGAAAAGTACAGAATCAGCACAGAAAACCT

TTGGGGTTTTTTGCTTGTTTGTTTGTTTGTTTGTTTGTTTGCAAAAATTGAAATTGAACATGAGAAACAATATATAAAACATCTAAATCCAGCATTCAAG

GAACTGTTTTGAGGTTAACCTACTCAAAAAATTTGACCTTTTAGTTTTACTTACAGAAGAGTGAATAAGAAAACCAGTGGGGGAAAATCTGATGGAATCA

GTGGAGAAGTTTTAGATAAAATTGAGCACTTCAGAAGAAGAGAAGGTAAAGTCAGTGTCCATTAAAGAAAACAGTCTCTCTCTCTGCGCAAGTGTGTATG

TATATACGTGTGCTTGTATATGTGTATGTATATATATGTGTGACCGTGTGTATGTGTCTTCTGCTCTGCTCTGCTCTCCTCTCACCTACTTCCCTGCACC

CCTCTTTTTCTGTCACCTCCCTCCTTTCAAAATGTAATTGAAAGTAGAACCACAAAGTCTAAATCTACCCTTCAAAAAGCAAGGACACAATACCAAGAAG

CATGAGTGGAGAAGAAACCTGCTAAAGAGATAGCAGAAGATTCAGTGTTTTCAACTTTGCAGTTTTGTTACCTTACGGTTGAAGAAAGGTTAAAAACTTT

GGTTTCCTGAAATTTGTGTTCTTTGTGTATTTGTACATGTGTACAGTTAATCTCTAACAAAAGCCAGAAGAAGTAACATTATTCGTTATGCTTTTTAAAG

TCACTTTCTTTGACTTTCCAAGAGAGAAAACTTACTCTATTGCTTATGTATAATATGGTTTTCTTAAAGTAGAGGTGTTTCTACTTTGTCCATCAAGTTG

TAATGAAAATAAGTTGTTTGCTCATGGAAATAATGTACTTAAAATGGTGAATTACAAAGCAGTCTACAGCCATACCACCCTGAATTTTCCCAGTCTTGTT

TGAATTTGGAAGAATGGTCAGGCCTGTGGAAGACCGGACTTCACAGAATCCTTTTAAGAATTTGTGTTAGTACTGGTGGTATTTTACTACTGTCATGTGG

TAACGTTTCTGTTTTCTCCAATGAAAATGTATGAAACAATGTAGACTTTTTCTGTTAAATCTAATTTGCAGTGTATTTTTGTATTTTCTAGTTCTGAAAG

TGGAAAATTAGTGTATAATAAATTAGATGATATATACTTTTAAAATGTTCTCCAAAAGGGCTGATAGAAATCGGTCTATATTCTGAAAAATGTTTATATT

AAAGTGTTTTAATTTCT
Translation
MAAAGRGDSSFKVDTCPCLRED - UNI34999 - DPTCDGQEQPAYFTDNFCKPCGVVLQHESERISHFE VCSSGEVNRNNFTDLHNMSFDSLAAAP

SHYVGKSHSPTQNQSLEEHDQVSPSTCSPKMD DEPNTTPAPPPFLKSVIVKPPPA AYRMRTYVCHICSITFTSLHMFRSHMQGTEHQIK KESHVINQ

VKNSKKMQESCQAECGDDIKMKKSRELEPKGHFREMEDNYMEAQAHEYREMVDSRPRHKMLEQTLPLENFWAHPGPYNDSRALEEQLPHNLPAESKTYDS

FQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYRERVDSEHRQRPCEERFSFEAPQTYQQEYSASPVEGQSPHWLPSHSKRRNDDFQNEFDDYNKV

QESRESEPKTSFRRMDSSFETHNYEEMVDRRSSHTMFEEGLPCETFQTYTDPYSSAQAVENTLPHCLPAYENQPSLDAESHYQLTTEEFSEMPASLSLSQ

QEDNPSSYNVDYDIYKHLPSNDNASAHETSHRRRRQKRKRHLEEGKERPEKEQSKHKRKRSYQDKDLDKDKLIKQSKREEDKAGVSSEKTKHRRKKRKHE

TSSEKEERKHKKEKKKSVEERTEEEILWDESILGF
Transcript ENSMUST00000085263
Sequence
ATTGTGCGCGCCAGGCTGCGACGGCGGCGGCGGCGGTGGCGTCGCCGAAAGCTGTAGCTCAGCTGGCGAGGTCTTCCCACCCTCGGGAAGTTCCCTAAGC

TGTCGCCTCCGCCGCCGCCTACGCGGCGGCAGCGGCGGCGGCCTTGCTGGTGCCTCCCTCCTCTGCCACCTCCACCCCTGCCTGCTCACTTGCCGGTGCT

GTGGAGAAGGCGGCGGCGGCTTTGGCGGCTCCACTATGGCGGCGGCGGGGAGGGGGGACAGTAGTTTTAAAGTAGACACCTGCCCTTGCCTCAGAGAAG 

- UNI34999 - ATCCCACGTGTGATGGACAAGAACAACCTGCGTATTTTACAGATAATTTTTGTAAACCATGTGGAGTGGTTCTACAGCATGAATCAG

AAAGGATTTCACATTTTGAG AGTGAAATACATGCTCAAAATGTTAAGTTCTTTTTTCAAATGCATGGAGAACAAAGCGAAGTGCCTGGTAGGAAAGTGA

ACATGCATGCTGGAAATTCTCAG GTGTGCTCGAGTGGAGAAGTCAACAGAAACAACTTTACTGATCTGCACAACATGAGTTTTGACTCCCTAGCTGCTG

CTCCATCTCACTATGTGGGAAAGAGCCATTCTCCGACTCAGAACCAGTCACTGGAAGAACATGATCAAGTATCTCCATCCACATGCTCACCAAAGATGG 

ATGAACCCAATACTACTCCTGCACCTCCACCCTTCCTGAAGTCTGTTATTGTGAAGCCTCCTCCAG CATATAGAATGAGAACCTACGTATGCCATATCT

GCAGTATCACCTTTACATCTTTACATATGTTCCGGTCCCACATGCAAGGAACTGAACATCAAATTAA AGAATCTCATGTTATCAATCAAGTGAAGAATT

CAAAGAAAATGCAAGAGTCTTGTCAAGCTGAGTGTGGAGATGACATCAAAATGAAGAAATCTAGAGAACTAGAGCCCAAGGGTCATTTCAGGGAAATGGA

GGATAATTACATGGAAGCCCAAGCCCATGAATACAGAGAAATGGTTGATTCTAGACCCAGACATAAAATGCTTGAACAAACACTTCCACTTGAAAATTTC

TGGGCACACCCAGGACCATACAATGATTCTAGAGCACTAGAAGAGCAGTTACCTCACAATTTACCAGCAGAGTCAAAGACATATGACTCTTTCCAAGATG

AACTTGAAGATTACATCAAAGGGCAGAAGGCCAGAGGACTTGATCCCAATACTAGTTTTAGACGGATGTCAGAAAGCTATAGGTATAGGGATCAGAGATA

CAGAGAAAGGGTTGATTCTGAACACAGACAGAGGCCTTGTGAGGAAAGATTTTCATTTGAGGCTCCACAGACCTAC AGCAAGAATACAGTGCCTCCCCA

GTGGAGGGCCAATCTCCTCACTGGTTACCATCTCATTCAAAGAGGAGAAATGATGATTTCCAAAATGAATTTGATGATTACA
Translation
 - UNI34999 -     MRTYVCHICSITFTSLHMFRSHMQGTEHQIK KESHVINQVKNSKKMQESCQAECGDDIKMKKSRELEPKGHFREMEDNYME

AQAHEYREMVDSRPRHKMLEQTLPLENFWAHPGPYNDSRALEEQLPHNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYRERVD

SEHRQRPCEERFSFEAPQTY SKNTVPPQWRANLLTGYHLIQRGEMMISKMNLMIT
Transcript ENSMUST00000064659
Sequence
ATTGTGCGCGCCAGGCTGCGACGGCGGCGGCGGCGGTGGCGTCGCCGAAAGCTGTAGCTCAGCTGGCGAGGTCTTCCCACCCTCGGGAAGTTCCCTAAGC

TGTCGCCTCCGCCGCCGCCTACGCGGCGGCAGCGGCGGCGGCCTTGCTGGTGCCTCCCTCCTCTGCCACCTCCACCCCTGCCTGCTCACTTGCCGGTGCT

GTGGAGAAGGCGGCGGCGGCTTTGGCGGCTCCACTATGGCGGCGGCGGGGAGGGGGGACAGTAGTTTTAAAGTAGACACCTGCCCTTGCCTCAGAGAAG 

- UNI34999 - ATCCCACGTGTGATGGACAAGAACAACCTGCGTATTTTACAGATAATTTTTGTAAACCATGTGGAGTGGTTCTACAGCATGAATCAG

AAAGGATTTCACATTTTGAG AGTGAAATACATGCTCAAAATGTTAAGTTCTTTTTTCAAATGCATGGAGAACAAAGCGAAGTGCCTGGTAGGAAAGTGA

ACATGCATGCTGGAAATTCTCAG GTGTGCTCGAGTGGAGAAGTCAACAGAAACAACTTTACTGATCTGCACAACATGAGTTTTGACTCCCTAGCTGCTG

CTCCATCTCACTATGTGGGAAAGAGCCATTCTCCGACTCAGAACCAGTCACTGGAAGAACATGATCAAGTATCTCCATCCACATGCTCACCAAAGATGG 

ATGAACCCAATACTACTCCTGCACCTCCACCCTTCCTGAAGTCTGTTATTGTGAAGCCTCCTCCAG CATATAGAATGAGAACCTACGTATGCCATATCT

GCAGTATCACCTTTACATCTTTACATATGTTCCGGTCCCACATGCAAGGAACTGAACATCAAATTAA AGAATCTCATGTTATCAATCAAGTGAAGAATT

CAAAGAAAATGCAAGAGTCTTGTCAAGCTGAGTGTGGAGATGACATCAAAATGAAGAAATCTAGAGAACTAGAGCCCAAGGGTCATTTCAGGGAAATGGA

GGATAATTACATGGAAGCCCAAGCCCATGAATACAGAGAAATGGTTGATTCTAGACCCAGACATAAAATGCTTGAACAAACACTTCCACTTGAAAATTTC

TGGGCACACCCAGGACCATACAATGATTCTAGAGCACTAGAAGAGCAGTTACCTCACAATTTACCAGCAGAGTCAAAGACATATGACTCTTTCCAAGATG

AACTTGAAGATTACATCAAAGGGCAGAAGGCCAGAGGACTTGATCCCAATACTAGTTTTAGACGGATGTCAGAAAGCTATAGGTATAGGGATCAGAGATA

CAGAGAAAGGGTTGATTCTGAACACAGACAGAGGCCTTGTGAGGAAAGATTTTCATTTGAGGCTCCACAGACCTACCAGCAAGAATACAGTGCCTCCCCA

GTGGAGGGCCAATCTCCTCACTGGTTACCATCTCATTCAAAGAGGAGAAATGATGATTTCCAAAATGAATTTGATGATTACAACAAGGTGCAGGAATCTA

GAGAATCCGAGCCAAAGACTTCTTTTAGAAGAATGGATAGCTCTTTTGAAACCCATAATTACGAAGAAATGGTTGACAGAAGATCCAGTCATACAATGTT

TGAGGAAGGACTCCCATGTGAGACTTTCCAGACTTACACAGATCCATACAGCAGTGCACAAGCAGTAGAAAACACGTTACCTCATTGCTTACCAGCTTAT

GAAAACCAACCGAGCCTAGATGCTGAAAGCCACTATCAGCTTACCACAGAGGAGTTCTCAGAAATGCCTGCTTCTCTGAGCCTCAGTCAACAAGAAGATA

ACCCTAGCTCATACAATGTAGACTATGACATTTACAAGCATCTGCCCTCAAATGACAATGCCAGTGCCCATGAAACAAGTCATAGAAGGCGACGTCAGAA

GAGAAAACGACACCTGGAGGAAGGAAAAGAAAGACCAGAGAAGGAACAGTCCAAACATAAAAGAAAAAGAAGCTATCAGGATAAAGATTTAGACAAAGAC

AAGCTCATCAAGCAAAGTAAGAGAGAGGAAGATAAAGCTGGAGTCAGCTCTGAAAAAACCAAGCATCGAAGAAAGAAAAGAAAACATGAAACATCCTCAG

AGAAAGAAGAACGTAAGCACAAAAAAGAGAAAAAGAAATCTGTTGAAGAGAGAACAGAAGAGGAAATCCTTTGGGATGAGTCAATTCTTGGGTTCTGACC

CTATGGTATACCAAGAAGGGCTAAAAGAAAATGATACTGATTTAGATACACACAGGAATAAGAGGAGAAACCAAGAAAAGTACAGAATCAGCACAGAAAA

CCTTTGGGGTTTTTTGCTTGTTTGTTTGTTTGTTTGTTTGTTTGCAAAAATTGAAATTGAACATGAGAAACAATATATAAAACATCTAAATCCAGCATTC

AAGGAACTGTTTTGAGGTTAACCTACTCAAAAAATTTGACCTTTTAGTTTTACTTACAGAAGAGTGAATAAGAAAACCAGTGGGGGAAAATCTGATGGAA

TCAGTGGAGAAGTTTTAGATAAAATTGAGCACTTCAGAAGAAGAGAAGGTAAAGTCAGTGTCCATTAAAGAAAACAGTCTCTCTCTCTGCGCAAGTGTGT

ATGTATATACGTGTGCTTGTATATGTGTATGTATATATATGTGTGACCGTGTGTATGTGTCTTCTGCTCTGCTCTGCTCTCCTCTCACCTACTTCCCTGC

ACCCCTCTTTTTCTGTCACCTCCCTCCTTTCAAAATGTAATTGAAAGTAGAACCACAAAGTCTAAATCTACCCTTCAAAAAGCAAGGACACAATACCAAG

AAGCATGAGTGGAGAAGAAACCTGCTAAAGAGATAGCAGAAGATTCAGTGTTTTCAACTTTGCAGTTTTGTTACCTTACGGTTGAAGAAAGGTTAAAAAC

TTTGGTTTCCTGAAATTTGTGTTCTTTGTGTATTTGTACATGTGTACAGTTAATCTCTAACAAAAGCCAGAAGAAGTAACATTATTCGTTATGCTTTTTA

AAGTCACTTTCTTTGACTTTCCAAGAGAGAAAACTTACTCTATTGCTTATGTATAATATGGTTTTCTTAAAGTAGAGGTGTTTCTACTTTGTCCATCAAG

TTGTAATGAAAATAAGTTGTTTGCTCATGGAAATAATGTACTTAAAATGGTGAATTACAAAGCAGTCTACAGCCATACCACCCTGAATTTTCCCAGTCTT

GTTTGAATTTGGAAGAATGGTCAGGCCTGTGGAAGACCGGACTTCACAGAATCCTTTTAAGAATTTGTGTTAGTACTGGTGGTATTTTACTACTGTCATG

TGGTAACGTTTCTGTTTTCTCCAATGAAAATGTATGAAACAATGTAGACTTTTTCTGTTAAATCTAATTTGCAGTGTATTTTTGTATTTTCTAGTTCTGA

AAGTGGAAAATTAGTGTATAATAAATTAGATGATATATACTTTTAAAATGTTCTCCAAAAGGGCTGATAGAAATCGGTCTATATTCTGAAAAATGTTTAT

ATTAAAGTGTTTTAATTTCT
Translation
MAAAGRGDSSFKVDTCPCLRED - UNI34999 - DPTCDGQEQPAYFTDNFCKPCGVVLQHESERISHFE SEIHAQNVKFFFQMHGEQSEVPGRKVN

MHAGNSQ VCSSGEVNRNNFTDLHNMSFDSLAAAPSHYVGKSHSPTQNQSLEEHDQVSPSTCSPKMD DEPNTTPAPPPFLKSVIVKPPPA AYRMRTYV

CHICSITFTSLHMFRSHMQGTEHQIK KESHVINQVKNSKKMQESCQAECGDDIKMKKSRELEPKGHFREMEDNYMEAQAHEYREMVDSRPRHKMLEQTL

PLENFWAHPGPYNDSRALEEQLPHNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYRERVDSEHRQRPCEERFSFEAPQTYQQE

YSASPVEGQSPHWLPSHSKRRNDDFQNEFDDYNKVQESRESEPKTSFRRMDSSFETHNYEEMVDRRSSHTMFEEGLPCETFQTYTDPYSSAQAVENTLPH

CLPAYENQPSLDAESHYQLTTEEFSEMPASLSLSQQEDNPSSYNVDYDIYKHLPSNDNASAHETSHRRRRQKRKRHLEEGKERPEKEQSKHKRKRSYQDK

DLDKDKLIKQSKREEDKAGVSSEKTKHRRKKRKHETSSEKEERKHKKEKKKSVEERTEEEILWDESILGF
Transcript ENSMUST00000087501
Sequence
ATGCATCAACAAGCTGCAACAAGCTCCCGCTGCCAAGGATGGAGTCCTCGCTACCAGGGATGGAGCCCCCGCTTCCAAGGATGGAGCCCCCGCTTCCATG

GATGGAACCCCCGCTTCCGTGGATGGAACCCCCACTGCCGTGGATGGAGCCCCTGCTTTCAAGGATGGAGCCCCCGCTGCCAAACCTTCCCTCCCAAGAT

CAACCGTATCTCCTCAAACT - UNI34999 - ATCCCACGTGTGATGGACAAGAACAACCTGCGTATTTTACAGATAATTTTTGTAAACCATGTGGAG

TGGTTCTACAGCATGAATCAGAAAGGATTTCACATTTTGAG AGTGAAATACATGCTCAAAATGTTAAGTTCTTTTTTCAAATGCATGGAGAACAAAGCG

AAGTGCCTGGTAGGAAAGTGAACATGCATGCTGGAAATTCTCAG GTGTGCTCGAGTGGAGAAGTCAACAGAAACAACTTTACTGATCTGCACAACATGA

GTTTTGACTCCCTAGCTGCTGCTCCATCTCACTATGTGGGAAAGAGCCATTCTCCGACTCAGAACCAGTCACTGGAAGAACATGATCAAGTATCTCCATC

CACATGCTCACCAAAGATGG ATGAACCCAATACTACTCCTGCACCTCCACCCTTCCTGAAGTCTGTTATTGTGAAGCCTCCTCCAG CATATAGAATGA

GAACCTACGTATGCCATATCTGCAGTATCACCTTTACATCTTTACATATGTTCCGGTCCCACATGCAAGGAACTGAACATCAAATTAA GAGGGCCCAAC

ATCTGTGGACCCATTGGCAGTGTACACAGCTCCT AGAATCTCATGTTATCAATCAAGTGAAGAATTCAAAGAAAATGCAAGAGTCTTGTCAAGCTGAGT

GTGGAGATGACATCAAAATGAAGAAATCTAGAGAACTAGAGCCCAAGGGTCATTTCAGGGAAATGGAGGATAATTACATGGAAGCCCAAGCCCATGAATA

CAGAGAAATGGTTGATTCTAGACCCAGACATAAAATGCTTGAACAAACACTTCCACTTGAAAATTTCTGGGCACACCCAGGACCATACAATGATTCTAGA

GCACTAGAAGAGCAGTTACCTCACAATTTACCAGCAGAGTCAAAGACATATGACTCTTTCCAAGATGAACTTGAAGATTACATCAAAGGGCAGAAGGCCA

GAGGACTTGATCCCAATACTAGTTTTAGACGGATGTCAGAAAGCTATAGGTATAGGGATCAGAGATACAGAGAAAGGGTTGATTCTGAACACAGACAGAG

GCCTTGTGAGGAAAGATTTTCATTTGAGGCTCCACAGACCTACCAGCAAGAATACAGTGCCTCCCCAGTGGAGGGCCAATCTCCTCACTGGTTACCATCT

CATTCAAAGAGGAGAAATGATGATTTCCAAAATGAATTTGATGATTACAACAAGGTGCAGGAATCTAGAGAATCCGAGCCAAAGACTTCTTTTAGAAGAA

TGGATAGCTCTTTTGAAACCCATAATTACGAAGAAATGGTTGACAGAAGATCCAGTCATACAATGTTTGAGGAAGGACTCCCATGTGAGACTTTCCAGAC

TTACACAGATCCATACAGCAGTGCACAAGCAGTAGAAAACACGTTACCTCATTGCTTACCAGCTTATGAAAACCAACCGAGCCTAGATGCTGAAAGCCAC

TATCAGCTTACCACAGAGGAGTTCTCAGAAATGCCTGCTTCTCTGAGCCTCAGTCAACAAGAAGATAACCCTAGCTCATACAATGTAGACTATGACATTT

ACAAGCATCTGCCCTCAAATGACAATGCCAGTGCCCATGAAACAAGTCATAGAAGGCGACGTCAGAAGAGAAAACGACACCTGGAGGAAGGAAAAGAAAG

ACCAGAGAAGGAACAGTCCAAACATAAAAGAAAAAGAAGCTATCAGGATAAAGATTTAGACAAAGACAAGCTCATCAAGCAAAGTAAGAGAGAGGAAGAT

AAAGCTGGAGTCAGCTCTGAAAAAACCAAGCATCGAAGAAAGAAAAGAAAACATGAAACATCCTCAGAGAAAGAAGAACGTAAGCACAAAAAAGAGAAAA

AGAAATCTGTTGAAGAGAGAACAGAAGAGGAAATCCTTTGGGATGAGTCAATTCTTGGGTTCTGACCCTATGGTATACCAAGAAGGGCTAAAAGAAAATG

ATACTGATTTAGATACACACAGGAATAAGAGGAGAAACCAAGAAAAGTACAGAATCAGCACAGAAAACCTTTGGGGTTTTTTGCTTGTTTGTTTGTTTGT

TTGTTTGTTTGCAAAAATTGAAATTGAACATGAGAAACAATATATAAAACATCTAAATCCAGCATTCAAGGAACTGTTTTGAGGTTAACCTACTCAAAAA

ATTTGACCTTTTAGTTTTACTTACAGAAGAGTGAATAAGAAAACCAGTGGGGGAAAATCTGATGGAATCAGTGGAGAAGTTTTAGATAAAATTGAGCACT

TCAGAAGAAGAGAAGGTAAAGTCAGTGTCCATTAAAGAAAACAGTCTCTCTCTCTGCGCAAGTGTGTATGTATATACGTGTGCTTGTATATGTGTATGTA

TATATATGTGTGACCGTGTGTATGTGTCTTCTGCTCTGCTCTGCTCTCCTCTCACCTACTTCCCTGCACCCCTCTTTTTCTGTCACCTCCCTCCTTTCAA

AATGTAATTGAAAGTAGAACCACAAAGTCTAAATCTACCCTTCAAAAAGCAAGGACACAATACCAAGAAGCATGAGTGGAGAAGAAACCTGCTAAAGAGA

TAGCAGAAGATTCAGTGTTTTCAACTTTGCAGTTTTGTTACCTTACGGTTGAAGAAAGGTTAAAAACTTTGGTTTCCTGAAATTTGTGTTCTTTGTGTAT

TTGTACATGTGTACAGTTAATCTCTAACAAAAGCCAGAAGAAGTAACATTATTCGTTATGCTTTTTAAAGTCACTTTCTTTGACTTTCCAAGAGAGAAAA

CTTACTCTATTGCTTATGTATAATATGGTTTTCTTAAAGTAGAGGTGTTTCTACTTTGTCCATCAAGTTGTAATGAAAATAAGTTGTTTGCTCATGGAAA

TAATGTACTTAAAATGGTGAATTACAAAGCAGTCTACAGCCATACCACCCTGAATTTTCCCAGTCTTGTTTGAATTTGGAAGAATGGTCAGGCCTGTGGA

AGACCGGACTTCACAGAATCCTTTTAAGAATTTGTGTTAGTACTGGTGGTATTTTACTACTGTCATGTGGTAACGTTTCTGTTTTCTCCAATGAAAATGT

ATGAAACAATGTAGACTTTTTCTGTTAAATCTAATTTGCAGTGTATTTTTGTATTTTCTAGTTCTGAAAGTGGAAAATTAGTGTATAATAAATTAGATGA

TATATACTTTTAAAATGTTCTCCAAAAGGGCTGATAGAAATCGGTCTATATTCTGAAAAATGTTTATATTAAAGTGTTTTAATTTCT
Translation
MHQQAATSSRCQGWSPRYQGWSPRFQGWSPRFHGWNPRFRGWNPHCRGWSPCFQGWSPRCQTFPPKINRISSNY - UNI34999 - YPTCDGQEQPAY

FTDNFCKPCGVVLQHESERISHFE SEIHAQNVKFFFQMHGEQSEVPGRKVNMHAGNSQ VCSSGEVNRNNFTDLHNMSFDSLAAAPSHYVGKSHSPTQN

QSLEEHDQVSPSTCSPKMD DEPNTTPAPPPFLKSVIVKPPPA AYRMRTYVCHICSITFTSLHMFRSHMQGTEHQIK KRAQHLWTHWQCTQLL LESH

VINQVKNSKKMQESCQAECGDDIKMKKSRELEPKGHFREMEDNYMEAQAHEYREMVDSRPRHKMLEQTLPLENFWAHPGPYNDSRALEEQLPHNLPAESK

TYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYRERVDSEHRQRPCEERFSFEAPQTYQQEYSASPVEGQSPHWLPSHSKRRNDDFQNEFDD

YNKVQESRESEPKTSFRRMDSSFETHNYEEMVDRRSSHTMFEEGLPCETFQTYTDPYSSAQAVENTLPHCLPAYENQPSLDAESHYQLTTEEFSEMPASL

SLSQQEDNPSSYNVDYDIYKHLPSNDNASAHETSHRRRRQKRKRHLEEGKERPEKEQSKHKRKRSYQDKDLDKDKLIKQSKREEDKAGVSSEKTKHRRKK

RKHETSSEKEERKHKKEKKKSVEERTEEEILWDESILGF

For any suggestions or comments, please send an email to unitrap@crg.es