Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052727 (Mtap1b)
Chromosomal location
Chr 13: 100194396 - 100286495 (-)
Description
microtubule-associated protein 1B Gene [Source:MGI Symbol;Acc:MGI:1306778]
RefSeq_dna
NM_008634 
RefSeq_peptide
NP_032660.2 
UniGene
Mm.4173 Mm.409176 Mm.414384 
MGI
MGI:1306778 
Uniprot/SWISSPROT
P14873 
Uniprot/SPTREMBL
A0PJ96 B2RQQ5 Q3TYV8 Q3TZM8 Q3UF78 Q3UPV4 Q8CAI9 Q8CFR9 
Human Ortholog
ENSG00000131711 (MAP1B)
Omim not available
UniTrap UNI14380
Vector Insertion
Chr 13: 100214168 - 100278165
Public Clones FHCRC-GT-S16-10A1_A10 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8355
Vector Insertion
Chr 13: 100197413 - 100199166
Public Clones XL067 (baygenomics) A061A07 (ggtc) A061F06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4114
Vector Insertion
Chr 13: 100195917 - 100197173
Public Clones AN0613 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064762
Sequence
AGAGGAGCGGCGGGAGAGGAACACTTCTCTCAGGCTTGAGCAGAGCCGGCAGGATGGCGACCGTGGTGGTGGAAGCCACCGAACCGGAGCCATCGGGCAG

CATCGGCAACCCGGCGGCGTCCACCTCGCCCAGCCTGTCGCACCGCTTCCTAGACAGCAAGTTCTACTTGCTGGTGGTGGTCGGCGAGACCGTAACCGAA

GAGCACCTGAGGCGTGCCATCGGCAACATCGAGCTGG - UNI14380 - GGATCCGATCGTGGGACACAAACCTGATTGAGTGCAACTTGGACCAGGA

ACTCAAACTTTTCGTATCTCGACACTCTGCAAGATTCTCTCCTGAAGTTCCAG - UNI14380 - GACAAAAGATTCTTCATCACCGAAGTGACGTCT

TAGAAACAGTCGTTCTGATCAACCCTTCAGATGAAGCCGTCAGCACTGAG - UNI14380 - GTGCGTTTGATGATCACTGACGCTGCCCGCCATAAA

CTGCTGGTGCTCACCGGACAGTGCTTTGAGAACACTGGCGAGCTCATCCTGCAGTCTGGCTCTTTCTCCTTCCAGAACTTCATAGAGATTTTCACAGATC

AAGAG ATTGGTGAGCTCCTAAGCACCACCCACCCTGCCAACAAAGCCAGCCTCACCCTCTTCTGTCCCGAGGAGGGAGACTGGAAGAACTCCAACCTTG

ACAGACACAATCTCCAAGACTTCATCAACATTAAGCTCAACTCAGCTTCTATCTTGCCAGAAATGGAGGGACTTTCTGAGTTCACCGAGTATCTCTCAGA

GTCTGTAGAAGTCCCCTCTCCCTTTGACATCCTGGAACCCCCAACCTCGGGCGGCTTTCTGAAGCTCTCCAAGCCTTGCTGTTACATTTTCCCAGGGGGC

CGTGGGGACTCGGCCCTGTTTGCAGTGAACGGATTCAACATGCTCATCAACGGAGGATCAGAGAGAAAGTCTTGCTTCTGGAAGCTCATCCGGCACTTGG

ACCGTGTGGACTCCATCCTGCTCACCCACATTGGGGATGACAATTTGCCTGGGATCAATAGCATGCTGCAGCGCAAGATTGCAGAGCTGGAAGAGGAGCG

GTCCCAGGGGTCCACCAGCAACAGTGACTGGATGAAAAACCTCATCTCCCCTGACCTGGGGGTTGTGTTTCTCAACGTACCTGAAAACCTGAAAGACCCA

GAACCCAACATCAAGATGAAGAGAAGCATAGAAGAAGCATGCTTCACTCTCCAGTACTTAAACAAACTGTCCATGAAACCAGAGCCTCTATTTAGAAGTG

TAGGCAATACCATTGAGCCTGTCATCCTGTTCCAGAAGATGGGAGTGGGCAAGCTTGAGATGTACGTGCTTAACCCAGTCAAAAGCAGCAAGGAAATGCA

GTATTTTATGCAACAGTGGACTGGCACCAACAAAGACAAGGCCGAACTAATCCTGCCCAATGGTCAAGAAGTAGACATCCCGATTTCCTACTTAACCTCA

GTCTCATCTTTGATTGTGTGGCATCCGGCCAACCCCGCTGAGAAAATCATTCGGGTTCTGTTTCCCGGAAACAGTACCCAGTACAACATCCTAGAAGGAC

TGGAGAAACTCAAACATCTAGATTTCCTAAAGCAGCCACTGGCCACCCAAAAAGATCTCACTGGCCAGGTGCCCACCCCCCCAGTGAAACAGGTCAAACT

GAAACAGCGGGCTGACAGCCGAGAGAGTCTGAAGCCAGCCACGAAACCAGTTGCCAGTAAATCTGTGAGGAAGGAGTCCAAGGAGGAAACCCCTGAAGTC

ACAAAGACTAGTCAAGTGGAGAAAACACCCAAAGTTGAAAGCAAAGAGAAAGTGTTAGTGAAAAAAGACAAGCCTGTAAAGACAGAAAGTAAACCTTCAG

TGACAGAAAAGGAGGTGTCCAGCAAGGAAGAGCAGTCCCCAGTGAAAGCCGAGGTCGCTGAGAAGCAAGCCACTGAGAGCAAACCCAAAGTCACCAAGGA

CAAAGTGGTAAAAAAGGAAATAAAGACAAAACTCGAGGAAAAGAAAGAGGAGAAGCCCAAGAAAGAAGTGGTTAAGAAGGAAGACAAAACACCCCTCAAG

AAAGACGAGAAGCCAAGAAAGGAAGAGGTGAAGAAGGAGATCAAGAAAGAAATCAAAAAAGAAGAGAGAAAGGAGCTGAAGAAAGAGGTGAAGAAGGAAA

CACCCCTGAAGGATGCCAAGAAGGAGGTGAAGAAAGAGGAGAAGAAAGAAGTTAAAAAGGAAGAGAAGGAACCCAAAAAGGAAATCAAGAAGATCTCCAA

GGACATAAAGAAATCAACTCCTCTGTCAGACACAAAGAAGCCATCTGCGTTAAAACCAAAAGTAGCGAAGAAAGAAGAGTCCACTAAGAAGGAGCCTCTT

GCTGCTGGGAAACTCAAGGACAAGGGGAAAGTCAAAGTCATTAAAAAGGAAGGCAAGACCACAGAAGCAGCTGCCACAGCTGTTGGCACTGCTGCCACCA

CAGCTGCCGTGGTGGCTGCAGCTGGAATAGCGGCCAGTGGTCCTGTCAAAGAACTGGAAGCTGAGAGGTCCCTTATGTCCTCCCCTGAGGATCTAACCAA

GGACTTTGAGGAGCTAAAGGCTGAGGAGATTGATGTGGCCAAGGACATCAAGCCTCAGCTGGAGCTCATTGAAGATGAAGAGAAACTGAAGGAAACCCAG

CCGGGAGAAGCCTACGTCATCCAGAAAGAGACGGAAGTCAGCAAAGGTTCCGCTGAGTCACCCGATGAGGGAATCACCACCACCGAGGGGGAGGGCGAGT

GTGAGCAAACCCCTGAGGAGCTGGAGCCAGTTGAGAAGCAGGGCGTGGATGACATTGAGAAGTTTGAAGATGAAGGAGCTGGTTTTGAAGAATCCTCAGA

GACCGGAGACTACGAAGAGAAGGCGGAAACTGAGGAGGCTGAGGAACCGGAAGAGGACGGGGAAGACAATGCGAGCGGGAGTGCCTCTAAGCACAGCCCC

ACAGAAGATGACGAAAGCGCAAAGGCTGAGGCGGACGTGCACCTCAAGGAGAAGAGGGAGTCTGTGGTCAGTGGTGACGACCGGGCGGAAGAAGACATGG

ATGATGTGCTTGAGAAAGGAGAAGCTGAACAGTCTGAGGAAGAGGGCGAAGAGGAGGACAAAGCAGAGGATGCCAGAGAGGAAGGCTATGAGCCCGACAA

AACTGAGGCTGAGGATTATGTGATGGCCGTGGCTGACAAGGCGGCTGAGGCTGGAGTCACAGAGGAGCAGTACGGATACCTGGGCACGTCGGCCAAGCAA

CCTGGAATCCAGTCTCCTAGCCGAGAACCTGCATCTTCAATTCATGATGAGACCCTACCTGGAGGCTCTGAGAGCGAGGCCACTGCTTCGGATGAGGAGA

ATCGGGAAGACCAGCCTGAGGAATTCACTGCTACCTCTGGATATACTCAGTCTACCATTGAGATATCTAGTGAGCCTACGCCAATGGATGAGATGTCTAC

TCCTCGTGATGTGATGAGCGACGAGACCAACAACGAGGAGACAGAGTCCCCATCTCAGGAGTTCGTAAACATTACCAAATATGAGTCCTCGCTGTATTCT

CAGGAGTACTCCAAACCTGCTGTTGCATCATTCAATGGATTGTCAGAAGGGTCAAAAACAGACGCCACTGATGGTAAGGATTACAACGCTTCCGCCTCCA

CCATATCACCACCTTCGTCCATGGAAGAAGACAAATTCAGCAAGTCTGCTCTTCGTGATGCTTACTGCTCAGAAGAGAAAGAGTTGAAAGCCAGTGCCGA

GTTAGACATCAAAGATGTTTCAGATGAGAGACTTAGCCCAGCCAAGAGTCCATCCCTGAGTCCTTCTCCGCCATCCCCCATAGAGAAGACTCCCCTGGGT

GAACGTAGCGTGAATTTCTCTCTGACACCCAATGAGATTAAAGTGTCAGCAGAGGGAGAAGCAAGGTCAGTGTCCCCTGGAGTGACCCAGGCAGTAGTTG

AAGAACATTGTGCCAGTCCTGAGGAGAAGACCCTGGAAGTAGTGTCGCCATCCCAGTCTGTGACAGGCAGTGCTGGCCACACACCTTACTACCAATCTCC

CACCGATGAGAAGTCCAGTCACCTACCCACAGAAGTCACTGAAAAGCCACAGGCAGTTCCAGTGAGCTTTGAATTCAGTGAGGCCAAAGATGAGAACGAG

AGAGCGTCCCTAAGCCCCATGGATGAGCCTGTGCCTGACTCAGAGTCTCCTGTGGAGAAGGTTCTGTCTCCTTTACGCAGTCCTCCCCTTCTTGGATCTG

AGTCCCCATATGAAGACTTCCTGAGTGCTGATAGCAAGGTTCTTGGCAGACGTTCCGAAAGCCCCTTTGAAGGGAAGAATGGAAAGCAGGGCTTCCCAGA

CAGAGAAAGCCCAGTTTCTGACCTGACTTCCACTGGTCTTTACCAAGACAAACAGGAAGAGAAAAGCACGGGCTTCATACCCATAAAGGAAGACTTTGGT

CCAGAAAAGAAAACCAGTGATGTTGAAACCATGAGTTCTCAATCAGCTCTAGCTTTGGATGAAAGGAAATTGGGAGGAGATGTATCTCCAACACAAATAG

ACGTCAGTCAGTTTGGCTCTTTCAAAGAAGACACCAAGATGTCCATTTCAGAAGGCACTGTTTCAGACAAGTCAGCCACACCTGTGGATGAGGGTGTGGC

AGAAGACACCTACTCCCACATGGAGGGTGTGGCCTCCGTCTCTACTGCCTCTGTGGCTACAAGTTCGTTTCCAGAGCCAACCACAGATGACGTGTCTCCT

TCTCTGCATGCCGAGGTGGGTTCTCCACATTCCACAGAAGTTGATGACTCCCTGTCCGTTTCTGTGGTGCAAACACCTACCACGTTCCAGGAAACAGAAA

TGTCTCCATCTAAAGAAGAGTGCCCAAGACCGATGTCAATTTCTCCTCCAGACTTCTCCCCCAAGACAGCCAAATCCAGGACACCAGTTCAAGATCACCG

ATCTGAACAGTCTTCTATGTCTATTGAGTTCGGCCAGGAATCCCCTGAGCATTCTCTTGCTATGGACTTTAGTCGGCAGTCTCCAGATCACCCTACTCTG

GGTGCCAGTGTGCTTCATATCACTGAAAACGGGCCAACTGAAGTGGACTATAGTCCCTCTGATATCCAGGACTCTAGTTTGTCGCATAAGATCCCGCCAA

CGGAAGAGCCATCCTACACCCAGGATAATGATCTGTCTGAGCTCATCTCTGTGTCTCAGGTAGAGGCTTCCCCGTCCACCTCTTCAGCTCACACCCCTTC

TCAGATAGCCTCTCCTCTTCAGGAAGACACTCTCTCTGATGTTGTTCCTCCCAGAGAGATGTCCTTATATGCCTCACTTGCGTCTGAAAAAGTGCAGAGC

CTGGAAGGAGAGAAGCTCTCTCCGAAATCTGATATTTCTCCACTCACCCCACGAGAGTCCTCACCTTTATATTCACCTGGCTTTTCAGATTCTACCTCTG

CAGCTAAAGAGACTGCAGCAGCTCACCAAGCCTCCTCTTCCCCACCAATAGATGCAGCAACAGCAGAGCCCTATGGCTTCCGCTCCTCAATGCTATTTGA

TACAATGCAACATCATCTGGCCTTGAATAGAGATTTGACTACATCTAGTGTGGAGAAAGACAGCGGAGGGAAGACACCCGGAGACTTTAACTATGCCTAT

CAAAAGCCTGAGAATGCCGCCGGATCTCCAGATGAAGAAGATTATGACTATGAATCTCAAGAGAAAACCATCCGGACCCACGACGTGGGTGGTTACTACT

ATGAGAAGACAGAGAGAACCATAAAATCCCCATGTGACAGTGGGTACTCCTATGAGACCATTGAGAAGACCATCAAGACCCCAGAAGATGGTGGCTACAC

CTGTGAAATTACCGAGAAAACCACTCGGACCCCAGAAGAGGGTGGCTATTCATATGAGATCAGCGAGAAGACGACACGGACCCCTGAAGTAAGCGGCTAC

ACCTATGAAAAGACTGAGAGGTCCAGAAGGCTCCTGGATGACATTAGCAATGGCTATGATGACACTGAGGATGGCGGCCACACACTTGGCGACTGTAGCT

ACTCCTATGAAACCACTGAGAAAATTACCAGCTTTCCTGAGTCTGAAAGCTATTCCTACGAGACAAGTACAAAAACAACACGGAGTCCAGACACCTCTGC

ATACTGTTACGAGACCATGGAGAAGATCACCAAGACCCCACAGGCATCCACATACTCCTATGAGACCTCAGACCGATGCTACACTACGGAAAAGAAGTCC

CCCTCAGAGGCACGCCAGGATGTTGATTTATGTCTGGTGTCCTCCTGTGAATTCAAGCATCCCAAGACGGAGCTCTCGCCTTCCTTCATTAATCCAAATC

CTCTTGAGTGGTTTGCTGGTGAAGAGCCCACTGAAGAATCAGAGAAGCCCCTCACTCAGTCTGGAGGAGCCCCCCCACCTTCAGGAGGAAAACAACAGGG

CAGGCAATGCGATGAAACGCCACCCACCTCAGTCAGTGAGTCAGCCCCATCCCAGACAGACTCTGATGTTCCCCCAGAGACGGAAGAGTGCCCCTCCATC

ACAGCCGACGCCAATATTGACTCTGAAGATGAGTCAGAAACTATCCCCACAGACAAAACCGTCACATACAAACACATGGACCCACCTCCAGCCCCCATGC

AAGACCGAAGCCCTTCTCCTCGCCACCCCGACGTGTCCATGGTGGACCCAGACGCCTTGGCCGTTGATCAGAACCTAGGCAAGGCTCTGAAAAAAGACCT

GAAGGAGAAGACCAAGACCAAGAAGCCAGGCACAAAGACCAAGTCCTCTTCACCTGTCAAAAAGGGTGATGGGAAGTCCAAGCCTTTAGCAGCTTCCCCC

AAACCAGGAGCTTTGAAGGAATCCTCCGACAAGGTGTCCAGAGTGGCTTCTCCCAAGAAGAAAGAATCCGTGGAAAAAGCTACAAAGACCACCACCACTC

CTGAGGTCAAAGCCACACGCGGAGAAGAGAAGGACAAGGAGACCAAGAACGCAGCTAACGCCTCTGCATCCAAATCAGCGAAGACCGCAACGGCAG - U

NI8355 - GACCAGGAACCACTAAGACAGCCAAGTCGTCCACCGTGCCTCCAGGCCTCCCTGTGTATTTGGACCTGTGCTATATTCCCAACCACAGCAA

CAGTAAGAATGTCGATGTTGAGTTCTTCAAGAGAGTGAGGTCATCTTACTACGTGGTGAGTGGGAACGACCCTGCCGCGGAGGAGCCCAGCCGGGCTGTC

CTGGATGCCTTGTTGGAAGGGAAGGCTCAGTGGGGAAGCAACATGCAG - UNI4114 - GTGACTCTGATTCCGACACATGACTCCGAGGTGATGAGG

GAGTGGTACCAGGAGACCCACGAGAAGCAGCAGGACCTCAACATCATGGTCTTAGCAAGCAGCAGTACAGTGGTCATGCAAGACGAGTCCTTCCCCGCAT

GCAAGATAGAACTGTAGAGACCGCAGCCGGCCACACCACAGGATTTGAACTGTGTTTCCAGAAATTCTTGAATTTGAAACTACCTTTTCTAAAACGTCCA

TTCATCCAATTAAGTCACTGAACAGTTATTACCTGCCAGATGCTATACTATGTCATGGTGATGCAAGTCACTGATAGTTCTCAATTTTTGCTGACTGCTA

AGGGAAGTAACCATATTCCCACAATAGATTTCGAGTTACTGCAAAATTGCCTACCCCCGTTCATCTCTGCTGAACATTCGGAAGCCATGCACTCACGCAC

CCAACTGACTTCTGCTAGGTATTGGCATTTATCATAGAGAGAGAAAGAGAGGGAAAGAGAGTCAGCGGGAGGGGAGGGAGAGAGGCGGGAGAGAGGGACA

AAGAGACTGCAGGAGAGAGAGAGAGAGTGAGAGGGGAAGAATCAGAAAGAAAAAGAATGCAAGAGACAAAGGTAGAGAGTTCTGATGAGATGCCCAGGGA

GAGAGAGTGGGCAAGATGGGGTATAGAGAAGACACCAGCAACCAGGTCTGCATTTTCTCAGACCACAGCTATTCTGTGGTCTACACAGGTGGAGTTTCCC

ATTTTCATCAGAGTCATCAGAAAGAGTCTTATTCTCCTAAAGCGTGTTTCTAAAGAACAAAAAGAATGAAGCCTGTTACGAGGGCATGAGCTTTTTCACG

CCTTAATTCAATGCCTTTGCTATTATAAAGGCTGCACACGGCATAATGTAGCAAGTGTAGACTGGATGAGTGAGTGGTTTGCGCCCCATTCAGAACTCTC

AGACTTTTCGAACACGTGAGTAGGTTGATCTAAGGCATGCTCCCAGCATTTGTCTACCCAAGTCCACACCAAGTCAAGCTGCATGCAGCAACACCCAAGT

CCACCCCGGTTAACTGAAGCAAATACCAAAGCAGGTGGGAGTACACATGGGAGACATTTTGCCTTAGGAAGTGACTTGAATGTACAAAGACACCTGATGC

ACTTATTTTTTAATGTGAGACAGCAAGTTTTTAAACCATCCATGTAGGATTGTAGATACTCCAGGGAAAGGAGCGTGTGGGGAGGGAAGGTACCAGAAGC

TCATCTGATTGGCCCAACGGTTTAGTGCAGAGTCATGCTTGGTGAACATCACCACTTCTGATGTACCCGTGGCCACTCAACCAAATCCGTTGCACCTTTC

GTAGCTTCTTTAATTCTTCAAGTTCAAGACCGGAATGGCTTCTTTGATCAGAACCAGGAAAACAGTGAATCTTATGGTGGAAGAGCTCTCAGCAAGTGTA

CAGCATCTGCCTTCCTTTGTCTTGCATTGGCTATTTTAATTTTCCATTAATTTCAACACATGGGAACACATGTACAGAAGAT
Translation
MATVVVEATEPEPSGSIGNPAASTSPSLSHRFLDSKFYLLVVVGETVTEEHLRRAIGNIELG - UNI14380 - GIRSWDTNLIECNLDQELKLFVSR

HSARFSPEVPG - UNI14380 - GQKILHHRSDVLETVVLINPSDEAVSTE - UNI14380 - VRLMITDAARHKLLVLTGQCFENTGELILQSGS

FSFQNFIEIFTDQE IGELLSTTHPANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVPSPFDILEPPTSGGFL

KLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLG

VVFLNVPENLKDPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIEPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAELILPN

GQEVDIPISYLTSVSSLIVWHPANPAEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPPVKQVKLKQRADSRESLKPATKPVASK

SVRKESKEETPEVTKTSQVEKTPKVESKEKVLVKKDKPVKTESKPSVTEKEVSSKEEQSPVKAEVAEKQATESKPKVTKDKVVKKEIKTKLEEKKEEKPK

KEVVKKEDKTPLKKDEKPRKEEVKKEIKKEIKKEERKELKKEVKKETPLKDAKKEVKKEEKKEVKKEEKEPKKEIKKISKDIKKSTPLSDTKKPSALKPK

VAKKEESTKKEPLAAGKLKDKGKVKVIKKEGKTTEAAATAVGTAATTAAVVAAAGIAASGPVKELEAERSLMSSPEDLTKDFEELKAEEIDVAKDIKPQL

ELIEDEEKLKETQPGEAYVIQKETEVSKGSAESPDEGITTTEGEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDG

EDNASGSASKHSPTEDDESAKAEADVHLKEKRESVVSGDDRAEEDMDDVLEKGEAEQSEEEGEEEDKAEDAREEGYEPDKTEAEDYVMAVADKAAEAGVT

EEQYGYLGTSAKQPGIQSPSREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPMDEMSTPRDVMSDETNNEETESPSQE

FVNITKYESSLYSQEYSKPAVASFNGLSEGSKTDATDGKDYNASASTISPPSSMEEDKFSKSALRDAYCSEEKELKASAELDIKDVSDERLSPAKSPSLS

PSPPSPIEKTPLGERSVNFSLTPNEIKVSAEGEARSVSPGVTQAVVEEHCASPEEKTLEVVSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVTEKPQAVP

VSFEFSEAKDENERASLSPMDEPVPDSESPVEKVLSPLRSPPLLGSESPYEDFLSADSKVLGRRSESPFEGKNGKQGFPDRESPVSDLTSTGLYQDKQEE

KSTGFIPIKEDFGPEKKTSDVETMSSQSALALDERKLGGDVSPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVAT

SSFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEHSLA

MDFSRQSPDHPTLGASVLHITENGPTEVDYSPSDIQDSSLSHKIPPTEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQIASPLQEDTLSDVVPPREM

SLYASLASEKVQSLEGEKLSPKSDISPLTPRESSPLYSPGFSDSTSAAKETAAAHQASSSPPIDAATAEPYGFRSSMLFDTMQHHLALNRDLTTSSVEKD

SGGKTPGDFNYAYQKPENAAGSPDEEDYDYESQEKTIRTHDVGGYYYEKTERTIKSPCDSGYSYETIEKTIKTPEDGGYTCEITEKTTRTPEEGGYSYEI

SEKTTRTPEVSGYTYEKTERSRRLLDDISNGYDDTEDGGHTLGDCSYSYETTEKITSFPESESYSYETSTKTTRSPDTSAYCYETMEKITKTPQASTYSY

ETSDRCYTTEKKSPSEARQDVDLCLVSSCEFKHPKTELSPSFINPNPLEWFAGEEPTEESEKPLTQSGGAPPPSGGKQQGRQCDETPPTSVSESAPSQTD

SDVPPETEECPSITADANIDSEDESETIPTDKTVTYKHMDPPPAPMQDRSPSPRHPDVSMVDPDALAVDQNLGKALKKDLKEKTKTKKPGTKTKSSSPVK

KGDGKSKPLAASPKPGALKESSDKVSRVASPKKKESVEKATKTTTTPEVKATRGEEKDKETKNAANASASKSAKTATAG - UNI8355 - GPGTTKTA

KSSTVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQ - UNI4114 - VTLIPTHDSEVMREW

YQETHEKQQDLNIMVLASSSTVVMQDESFPACKIEL

For any suggestions or comments, please send an email to unitrap@crg.es