Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052794 (1700030K09Rik)
Chromosomal location
Chr 8: 74967825 - 74984540 (+)
Description
RIKEN cDNA 1700030K09 gene Gene [Source:MGI Symbol;Acc:MGI:1919504]
RefSeq_dna
NM_028170 
RefSeq_peptide
NP_082446.1 
UniGene
Mm.275872 
MGI
MGI:1919504 
Uniprot/SWISSPROT
Q922C1 
Uniprot/SPTREMBL
Q9CVT9 
Human Ortholog
ENSG00000105072 (C19orf44)
Omim not available
UniTrap UNI30952
Vector Insertion
Chr 8: 74967889 - 74968648
Public Clones IST12325H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121902
Sequence
CTGGGGCCTATACTTTGAGGCTGAAGCCTAGCGGGAAGAAGCCAACGCAGCTACTCAG - UNI30952 - AATGGCTTCCACAAGAAGACCCTTTGGC

CCTCCACGTAGTGGTTTTGACTTAAGGGATATGTTCTTAGATAGCTCGAGGATGGAAGAGATCAGAAACTTACAAGCCCGAAGTCTTGGCCAAGTGACAC

CTGGGCAGAGCAGAATCTTAAAGAGAAACCAAACGATGGACGAGAAATATTTGATGCCCAAAGAGGAGGCCATGGCAGGGAGGGGGGTGAGTCTGGGCTT

GAGGCCTCCCACCATCTCCTCCAAGACCAGAGCCAGTGAGGCCCTTAGGAAACTGGCCCAGATTGAAACCAAGATCCTGAATCGGAAGCAGGTGCCCATG

GCTTGGTCTGATGTGGAGTCTGACTCCACATCCATCGAGCAGAGTCTTCCTAAGAGGACAGGTGCAGCTTCTGTTTCTTCCCAGTACCCACACAGAACTT

TCCAGAAACAAGTGAACAAAACATGTGTGTCAAAGAGCGATGGGCCGAGTGGTAACGGTAGCAGGTTTCTGAAGAAGAAGGAGCTGCCCACTGAAGCGAG

GTCCCCAGGGCTGGCAGTGGGGACAGGGAAGCAAGCTCTGCTGCCCACAAAGAAAGAATCTGCCAGTGACGAGGAGGAGGAAATGCTACTGCTTAGAAGC

TTGATGGAATCTTCTAGAGAAAAAGAAGCAAATAGAAACCAGGAGCTCCCTGGCTCCAGTGTCAGCAGGAGCAACCTTGGAAAGGTGTTCTTG GATCCA

ACTCCAGATCAGCCAGGAGTCCTGTCTCTACTCAGTGTTGACCAGTCCAGCTTAAAGTCTCCTCGGCCCATACAGTCGACTCGCGTTGGCTTGAGAACTC

ACTCCCGACAGGCGAGCAGTGCTGGGGACACAGTCTCCATCACAGCCTCACCTCCCATCCTTGATGACTTCTCCAAATCAGCATCTTCAAAGATGGGATG

CATCAAGCTGGCTTCCTCCCCCAGCAGGACGGAGTTGGAGTCTTCTGAGGAACCAGTCTCAGAAGCTGCTGCTGACAGCCTCCATG ATTTTAGAATTAA

TATTTTGTCGATTGATGATCTGGTTCTGGCTGACGGAGACAAATCAGATGGGGACCAGAGA GGCACAGCCACCGTGGTTGGGGATGGAGAGGGTCTTAC

CACTGAGAGTGACGTCTCAGAGCCCCCGGGGACCAGCTCCTCAGCAGCTGTCCAGTCTCACAGTATGTCCAGGGCCCTCACTGCAAGCCCAGCTTACTCA

GAGGATTTTGAGCAGTTCTCTGGTCCCTTGGCCTTGGAGGAGTCGCTTGACAGGACACTGGACACTTTGTCAAAGTTTTCTTCCAGTGGTCAGACAGATA

TCGTTGCCAGACAACCTCTATCAAGGACAGAATGGGGCAGGGGTGTGACCAGAGTTGTGAAGGAGACAGCTGTGCAGACACTTGATCCTGCCTTTGCCTA

CCAGTGGAGCAAGG CTGGTGGCATAGCAGCTGTTGGACCTGCCCTTGGAGGTGCTTATGTGGACCCAGCACCCATCGCCAGTCACATTGTCAGCGCAGA

CGCCATAGAAG CCCTGACAGCCTACAGCCCAGCAGTTCTGGCGTTGAATGACATGCTAAAGCAACAACTGAGCCTGACGCAGCAGTTCATCGAGGCCAG

CCATCAACTACATGGTTCTCTCCTGCAGTCCCTGGATGGGGACTCATTTCACTACCATACCTTGGAGGAAGCAAAAGAG TACATCAGATGCCACAGGCC

TGCACCCCTGACCATGGAGGCTGCCCTGCAGGAGGTGAGGGAGGAGCTCCAAGTCCCAGCAAGTGAGGCTTGCCTGGGTACCTGTCCACCTCGGAATCAA

TGACATCCATATGGAGGCAGGCAAGGTTGGGGTTCTCCCTGCTCAATAACAATCATATATGGACTCTACGCTCCCATCTGCCCAGCTGGCTGCTCTGAGG

ATACAGCATGAGAACAGCTGAGAACCCATCACAGGACAGTGGTGTGGTATGGGGCCATGAGCCAGTTGGACAGACAACATGTGTTAGGCATTCCAATCAT

CCAAGATGGGACCAGCTGCCCCATGGGAACACTCCATGCCAGGTGCTGAAACAGGTATGAGCCTGGTGCCTGGGCACAGCCTGCATCTATCCAGAGCAGC

CTGCACAGTATCTCTCATCCACAGCTAGAGGAAATCTTTTACAAAAGGCTTTATTGGAAGGCAAAACAGTAAAATCCACAATTGTTAACAGCACATGTGT

GTCTGCTTGTTTATCCTGAGTCAGACACATCTGAACGTCATAGGTATGGGAAATCTAAAACAAAAATCAAGTGTCTTATATGATACTGAAAAA
Translation
 - UNI30952 - MASTRRPFGPPRSGFDLRDMFLDSSRMEEIRNLQARSLGQVTPGQSRILKRNQTMDEKYLMPKEEAMAGRGVSLGLRPPTISSKTR

ASEALRKLAQIETKILNRKQVPMAWSDVESDSTSIEQSLPKRTGAASVSSQYPHRTFQKQVNKTCVSKSDGPSGNGSRFLKKKELPTEARSPGLAVGTGK

QALLPTKKESASDEEEEMLLLRSLMESSREKEANRNQELPGSSVSRSNLGKVFL DPTPDQPGVLSLLSVDQSSLKSPRPIQSTRVGLRTHSRQASSAGD

TVSITASPPILDDFSKSASSKMGCIKLASSPSRTELESSEEPVSEAAADSLHD DFRINILSIDDLVLADGDKSDGDQR GTATVVGDGEGLTTESDVSE

PPGTSSSAAVQSHSMSRALTASPAYSEDFEQFSGPLALEESLDRTLDTLSKFSSSGQTDIVARQPLSRTEWGRGVTRVVKETAVQTLDPAFAYQWSKA A

GGIAAVGPALGGAYVDPAPIASHIVSADAIEA ALTAYSPAVLALNDMLKQQLSLTQQFIEASHQLHGSLLQSLDGDSFHYHTLEEAKE YIRCHRPAPL

TMEAALQEVREELQVPASEACLGTCPPRNQ
Transcript ENSMUST00000064853
Sequence
CGCACACTGGGGCCTATACTTTGAGGCTGAAGCCTAGCGGGAAGAAGCCAACGCAGCTACTCAG - UNI30952 - AATGGCTTCCACAAGAAGACCC

TTTGGCCCTCCACGTAGTGGTTTTGACTTAAGGGATATGTTCTTAGATAGCTCGAGGATGGAAGAGATCAGAAACTTACAAGCCCGAAGTCTTGGCCAAG

TGACACCTGGGCAGAGCAGAATCTTAAAGAGAAACCAAACGATGGACGAGAAATATTTGATGCCCAAAGAGGAGGCCATGGCAGGGAGGGGGGTGAGTCT

GGGCTTGAGGCCTCCCACCATCTCCTCCAAGACCAGAGCCAGTGAGGCCCTTAGGAAACTGGCCCAGATTGAAACCAAGATCCTGAATCGGAAGCAGGTG

CCCATGGCTTGGTCTGATGTGGAGTCTGACTCCACATCCATCGAGCAGAGTCTTCCTAAGAGGACAGGTGCAGCTTCTGTTTCTTCCCAGTACCCACACA

GAACTTTCCAGAAACAAGTGAACAAAACATGTGTGTCAAAGAGCGATGGGCCGAGTGGTAACGGTAGCAGGTTTCTGAAGAAGAAGGAGCTGCCCACTGA

AGCGAGGTCCCCAGGGCTGGCAGTGGGGACAGGGAAGCAAGCTCTGCTGCCCACAAAGAAAGAATCTGCCAGTGACGAGGAGGAGGAAATGCTACTGCTT

AGAAGCTTGATGGAATCTTCTAGAGAAAAAGAAGCAAATAGAAACCAGGAGCTCCCTGGCTCCAGTGTCAGCAGGAGCAACCTTGGAAAGGTGTTCTTG 

GATCCAACTCCAGATCAGCCAGGAGTCCTGTCTCTACTCAGTGTTGACCAGTCCAGCTTAAAGTCTCCTCGGCCCATACAGTCGACTCGCGTTGGCTTGA

GAACTCACTCCCGACAGGCGAGCAGTGCTGGGGACACAGTCTCCATCACAGCCTCACCTCCCATCCTTGATGACTTCTCCAAATCAGCATCTTCAAAGAT

GGGATGCATCAAGCTGGCTTCCTCCCCCAGCAGGACGGAGTTGGAGTCTTCTGAGGAACCAGTCTCAGAAGCTGCTGCTGACAGCCTCCATG ATTTTAG

AATTAATATTTTGTCGATTGATGATCTGGTTCTGGCTGACGGAGACAAATCAGATGGGGACCAGAGA GAGGAAGACTGTGTAAGGGAAGGGATTTCAGT

CAGAAGCTCCTCACCCACATCACCTACTCGACTGGAAGCGCAGATGTGGCCCAAGAATTGTGTGTTTCAGGGCACAGCCACCGTGGTTGGGGATGGAGAG

GGTCTTACCACTGAGAGTGACGTCTCAGAGCCCCCGGGGACCAGCTCCTCAGCAGCTGTCCAGTCTCACAGTATGTCCAGGGCCCTCACTGCAAGCCCAG

CTTACTCAGAGGATTTTGAGCAGTTCTCTGGTCCCTTGGCCTTGGAGGAGTCGCTTGACAGGACACTGGACACTTTGTCAAAGTTTTCTTCCAGTGGTCA

GACAGATATCGTTGCCAGACAACCTCTATCAAGGACAGAATGGGGCAGGGGTGTGACCAGAGTTGTGAAGGAGACAGCTGTGCAGACACTTGATCCTGCC

TTTGCCTACCAGTGGAGCAAGG CTGGTGGCATAGCAGCTGTTGGACCTGCCCTTGGAGGTGCTTATGTGGACCCAGCACCCATCGCCAGTCACATTGTC

AGCGCAGACGCCATAGAAG CCCTGACAGCCTACAGCCCAGCAGTTCTGGCGTTGAATGACATGCTAAAGCAACAACTGAGCCTGACGCAGCAGTTCATC

GAGGCCAGCCATCAACTACATGGTTCTCTCCTGCAGTCCCTGGATGGGGACTCATTTCACTACCATACCTTGGAGGAAGCAAAAGAG TACATCAGATGC

CACAGGCCTGCACCCCTGACCATGGAGGCTGCCCTGCAGGAGGTGAGGGAGGAGCTCCAAGTCCCAGCAAGTGAGGCTTGCCTGGGTACCTGTCCACCTC

GGAATCAATGACATCCATATGGAGGCAGGCAAGGTTGGGGTTCTCCCTGCTCAATAACAATCATATATGGACTCTACGCTCCCATCTGCCCAGCTGGCTG

CTCTGAGGATACAGCATGAGAACAGCTGAGAACCCATCACAGGACAGTGGTGTGGTATGGGGCCATGAGCCAGTTGGACAGACAACATGTGTTAGGCATT

CCAATCATCCAAGATGGGACCAGCTGCCCCATGGGAACACTCCATGCCAGGTGCTGAAACAGGTATGAGCCTGGTGCCTGGGCACAGCCTGCATCTATCC

AGAGCAGCCTGCACAGTATCTCTCATCCACAGCTAGAGGAAATCTTTTACAAAAGGCTTTATTGGAAGGCAAAACAGTAAAATCCACAATTGTTAACAGC

Translation
 - UNI30952 - MASTRRPFGPPRSGFDLRDMFLDSSRMEEIRNLQARSLGQVTPGQSRILKRNQTMDEKYLMPKEEAMAGRGVSLGLRPPTISSKTR

ASEALRKLAQIETKILNRKQVPMAWSDVESDSTSIEQSLPKRTGAASVSSQYPHRTFQKQVNKTCVSKSDGPSGNGSRFLKKKELPTEARSPGLAVGTGK

QALLPTKKESASDEEEEMLLLRSLMESSREKEANRNQELPGSSVSRSNLGKVFL DPTPDQPGVLSLLSVDQSSLKSPRPIQSTRVGLRTHSRQASSAGD

TVSITASPPILDDFSKSASSKMGCIKLASSPSRTELESSEEPVSEAAADSLHD DFRINILSIDDLVLADGDKSDGDQR EEDCVREGISVRSSSPTSPT

RLEAQMWPKNCVFQGTATVVGDGEGLTTESDVSEPPGTSSSAAVQSHSMSRALTASPAYSEDFEQFSGPLALEESLDRTLDTLSKFSSSGQTDIVARQPL

SRTEWGRGVTRVVKETAVQTLDPAFAYQWSKA AGGIAAVGPALGGAYVDPAPIASHIVSADAIEA ALTAYSPAVLALNDMLKQQLSLTQQFIEASHQL

HGSLLQSLDGDSFHYHTLEEAKE YIRCHRPAPLTMEAALQEVREELQVPASEACLGTCPPRNQ

For any suggestions or comments, please send an email to unitrap@crg.es