Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000052974 (Cyp2f2)
Chromosomal location
Chr 7: 27904974 - 27918678 (+)
Description
cytochrome P450, family 2, subfamily f, polypeptide 2 Gene [Source:MGI (curated);Acc:Cyp2f2-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37345
Vector Insertion
Chr 7: 27917635 - 27918234
Public Clones CMHD-GT_443B8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000003100
Sequence
ACACACATACACTGCAGCACACACAAGAACTTCAGAACATTGCTGCAGAATACTGATACAG GCGCTGCAGCTGCCTTCACTATGGATGGTGTGAGCACA

GCCATCTTGCTTCTCCTCCTGGCTGTCATCTCTCTGTCCCTGACCTTCAGCTCACGGGGCAAGGGCCAGCTGCCTCCAGGACCCAAACCTCTCCCAATCC

TGGGAAACCTGCTGCAGCTTCGCTCCCAAGACTTGCTGACCTCCCTCACCAAG CTTAGCAAGGAGTATGGGTCGGTGTTCACGGTGTACCTGGGGTCCA

GGCCTGTGATAGTCCTCAGCGGATACCAAACTGTGAAGGAGGCTCTTGTGGACAAAGGGGAGGAGTTCAGTGGCCGAGGCGCATACCCCGTCTTTTTCAA

CTTCACCAGGGGCAACG GCATCGCCTTCTCCGATGGAGAGCGCTGGAAGATCCTCAGAAGGTTCTCTGTCCAAATCCTGCGGAACTTTGGCATGGGAAA

AAGAAGCATCGAGGAGCGGATCCTGGAAGAAGGCAGCTTCCTGCTGGAGGTGCTGAGGAAAATGGAAG GCAAGCCCTTTGACCCCGTGTTTATCCTGAG

CCGCTCTGTGTCCAACATTATCTGCTCTGTCGTCTTCGGAAGTCGCTTCGACTATGACGATGAGCGTCTGCTCACCATCATCCACTTTATCAATGACAAC

TTCAAGATTATGAGCAGCCCTTGGGGCGAG ATGTACAACATCTTCCCAAGTGTCCTTGATTGGATACCTGGGCCACACAAACGCTTGTTCCGGAACTTT

GGAGGCATGAAAGATCTCATTGCCCGCAGCGTCCGCGAACACCAGGATTCCCTGGACCCCAACTCTCCCCGGGACTTCATCGACTGCTTCCTCACAAAGA

TGGCACAG GAGAAGCAAGACCCACTGAGCCACTTCAATATGGATACCCTGCTGATGACCACACACAACCTGCTCTTCGGTGGCACAGAAACCGTGGGCA

CCACACTGCGTCACGCCTTCCTTATTCTTATGAAATACCCCAAAGTGCAAG CCCGCGTGCAGGAAGAGATTGACCGTGTGGTGGGGCGCTCGCGGATGC

CGACGCTGGAAGACCGTACATCCATGCCTTACACAGATGCAGTGATCCACGAAGTGCAACGCTTTGCTGACGTCATCCCCATGAACCTGCCTCACCGTGT

CACTCGGGACACACCTTTCCGGGGCTTCCTGATACCCAAG GGCACAGATGTCATCACACTCCTTAACACTGTGCACTACGACTCGGACCAGTTCAAGAC

GCCTCAGGAGTTCAATCCTGAACATTTTCTGGACGACAATCATTCTTTCAAAAAGAGCCCCGCCTTCATGCCATTTTCGGCTG - UNI37345 - GAC

GTCGACTGTGTCTGGGAGAGCCACTGGCGCGCATGGAGCTCTTCATATACTTCACCTCCATTCTGCAGAACTTCACATTGCAGCCGCTGGTGGATCCTGA

GGACATCGACCTGACCCCGCTCAGCTCAGGGCTGGGCAATTTGCCAAGGCCTTTCCAGCTGTGTATGCACATTCGCTGAGTACTGCGCCCAGGGACCCCT

GTCCTTCTTCCAGTTGGGGTTCACTGTCATAGGCCTCCATTGATATCTCTCTCACATGATCTTCCCTTAACCCTGGGCCTGCCACGTATCAGTACTTTAC

CCCGCCTATCTTAAGCCCATCTTCATGGAAAGAATGACGTGACAAAGGTGAAATACCCGTCTTATACGCACAGAACCTATTCTATGATGCACCCTTTTCC

TGTCTGTTTGTATCATTTCCTAGTAAATATCTTAATAACTG
Translation
 MDGVSTAILLLLLAVISLSLTFSSRGKGQLPPGPKPLPILGNLLQLRSQDLLTSLTK LSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGR

GAYPVFFNFTRGNG GIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEG GKPFDPVFILSRSVSNIICSVVFGSRFDYDDER

LLTIIHFINDNFKIMSSPWGE MYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSPRDFIDCFLTKMAQ EKQDPLSHFNMDTLLMTT

HNLLFGGTETVGTTLRHAFLILMKYPKVQA ARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHEVQRFADVIPMNLPHRVTRDTPFRGFLIPK GTDVI

TLLNTVHYDSDQFKTPQEFNPEHFLDDNHSFKKSPAFMPFSAG - UNI37345 - GRRLCLGEPLARMELFIYFTSILQNFTLQPLVDPEDIDLTPLS

SGLGNLPRPFQLCMHIR

For any suggestions or comments, please send an email to unitrap@crg.es