Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053007 (9430076C15Rik)
Chromosomal location
Chr 6: 53237289 - 53645827 (+)
Description
cAMP responsive element binding protein 5 Gene [Source:MGI Symbol;Acc:MGI:2443973]
RefSeq_dna
NM_172728 
RefSeq_peptide
NP_766316.1 
UniGene
Mm.321138 
MGI
MGI:2443551 MGI:2443973 
Uniprot/SWISSPROT
Q8K1L0 
Uniprot/SPTREMBL
Q4G0C6 Q3TLH8 
Human Ortholog
ENSG00000146592 (CREB5)
Omim not available
UniTrap UNI38720
Vector Insertion
Chr 6: 53344506 - 53397539
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14854
Vector Insertion
Chr 6: 53397713 - 53523367
Public Clones PST4896-NR (escells) PST4896-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047450
Sequence
ACTCATTCCACAGCTCTCCTATTCTGCACCTCAGGAGGGAACTCAGCCTCAGTGATGTCCATGAG GCCTGTCCCAGGCTCTCTATCATCTCTACTCCAT

CTCCACAACAGACAGAGGCAGCCCATGCCGGCCTCCATGCCTGGAACCCTGCCCAACCCCACCATGCCAGGATCTTCTGCCGTCTTGATGCCT ATGGAG

AGACAGATGTCAGTGAACTCCAGCATCATGGGCATGCAAGGTCCAAACCTCAGCAACCCCTGTGCTTCTCCCCAAGTCCAGCCAATGCATTCAGAAGCCA

AAATG AGACTGAAGGCTGCGCTGACTCACCATCCTGCCGCCATGTCGAACGGGAACATGAGCACCATCGGACACATGATGGAGATGATGGGCTCCCGGC

AAGACCAGACACCGCACCACCACCTGCACTCACACCCGCATCAGCACCAGACACTGCCGCCCCACCACCCCTACCCACACCAGCACCAGCACCCCGCACA

CCATCCCCACCCACAGCCTCACCACCAGCAGAACCACCCGCACCACCACTCCCATTCCCACCTTCACGCACACCCGGCGCACCACCAGACCTCGCCACAC

CCACCCCTGCCCACCGGCAACCAAGCACAG GTTTCACCAGCTACACAACAGATGCAGCCAACCCAGACAATACAACCGCCCCAGCCCACAGGGGGACGC

CGGCGAAGAGTGGTGGATGAGGACCCAGATGAGAGGCGGAGGAAATTTCTGGAAAGGAACCGGGCCGCCGCCACCCGCTGCAGACAGAAGAGGAAGGTCT

GGGTGATGTCACTGGAAAAGAAAGCTGAAGAGCTCACCCAGACAAACATGCAGCTTCAG AATGAAGTGTCCATGTTGAAAAACGAGGTGGCCCAGCTGA

AGCAGTTGTTGTTAACACATAAAGACTGTCCGATAACAGCCATGCAGAAAGAATCCCAAGGGTATTTAA GTCCAGAGAGCAGCCCTCCTGCGAGCCCTG

TGCCAGCATGCTCTCAGCAGCAAGTTATCCAACACAACACCATCACTACATCCTCATCGGTCAGCGAGGTCGTGGGGAGCTCCACCCTCAGTCAGCTTAC

AACTCACAGAACAGACCTGAATCCTATTCTTTAAAAGGCATCGGTCAAACCTGGCCTTTGAGAAGAGCTGTAGCATGCCGTACATCCTTTCTCAAAGGGG

CATTTTTTTTAGAATTATCTCAGACCTGGAAGACGCCTCAGCCCTTCAAAGACTGGCTTTCATTTTTATAGTTATTATGGAAATGTTGTCTTTTATACTT

AGTTATATAAGAAAAAAGGGAGATATGCAATGAATATCTATCAGCTTGGGGAGCACGTTGGTGCTTCTCTGCAATTTTCTGGTACCAGTTTCTTGTTTAT

AAACGGAACCTTTCCTGTATATAGCCATGGTTTCATTCTTACCAGCCCAACCCTTTGCCTGGAACAATGAATCTTGTTCAACTACAGCTTTTAGCCAAAA

TGAGGTATGCTTAGATGTCAAGCGAGATGGATCCACACAGTAACTGGGTGGGAAAGCTCATGATGTCATAACTCATGTTGAGTTTGTGCTGTGATGTCAC

CAGAATCTCAGATAAACACATGGGCCTTCCTGAATATTTTTTTCTCTTGCTAGAAAAAAATAAATTATGGTCCATCCATATCCCATGAAAGCCACCAAGC

ATCTCAGGCCCCCTCCTTCCTCTCTTTTCTACTTGCGCAGATGTCCAATATCCATCTCATTTTCCTTTCCCCGGATCCCTTGTTTACTCTTTGTTTTGAC

TTTTTTTCTGTTTCCTTTTCTCCCCTTTAGCTTTGCATGTAAAAAAGAAAATAATGTTTAAAGAAGAGAAAAAGCAAATCTGGAAACTGTGGACCTAGCC

ACAGTTTAACCCACAGCTGGAGTTCATTCAATTTTTGCCTTTCACAAAATAGCAACCAGGAGATGTTTAATGTGCCTGATTTAATGTTTTTAATAACCAG

AGCAAATAAAAGGTGGTTTGGTTATAGGTGAAGCACTGTTGAATGCCAGCTGTGGGGACACTAGGGAAAGGGACTTCGTAAGCTCCAACTGTGAAAATTC

AAATAAGGATGTGGGCTCTAACATCACACCCTCGAATTACAGCTCGCTTCTATGGCCTGTCTATAATGTAAAAAATCCATGCACTATATAATAGTTCAGA

AGGGCTCTGTTCACTACACAGATTACATTGTTCAATCATCAGCTGCTAATAACCTAAGATTTATTATTATTATTTTTCTTAAGCCTATGGAACCAGCTCT

GCTGTTCTGGTGGGCAAAAGCAAACTCACTCTTGGAGCAACAGAGAGAAAGCGAGGCCAGCGTTTCTCGGGGACTCGCAGTCTGCCAGAACAGTCAGACT

CCTTGGCTGCTGACCGAGTCCCATGGAGGTGGCCAGGCTGGTGCGCTCATCTGAGTAGTTCTGATTTATATTTTCAGCAATGTCCACGGACTTGCCCATT

ACGGAAAGCAGATCAAACCCAAACCACAGTTGTGCCTCCTTGAAACAAGCCATTCTACTCTGCTGGTGTTTTACTATCGTGTTTCACAAATAATAGGGGC

TAATGTTTCTCACTAGCAGTCTGGGCATATGCTGGTGTTTCATCTCTGCCCAAATAATTCACCTCCTAACCTATGTGTGTGTGTGTGCACATGGATGTGT

GTGCCTGAGTGTGTGAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTTATGAACAGTATAGGTTTTAAAAGAACAGTATTTTACAAAAGC

CATCACTTTTATAAGAGTTCTGTAAAGGAAGGATGTACTTCTTCGCTCACTATAGTTTAAAAAAAATTCTATTTTAGAGG
Translation
MSMR RPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMP MERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKM RLKAALTHHPAAM

SNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLPTGNQAQ VSPA

TQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQ NEVSMLKNEVAQLKQLLLTHKDCPITA

MQKESQGYLS SPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL
Transcript ENSMUST00000047462
Sequence
AGAATGTATTGTAATCTTTGCTCAGTCCAACGTGGTCCCTTCACCCGGGCTCGGCTCTTGCCTTCTCCACACTTGTTTG ATTTATGAGGAATCCAAGAT

GAACTTGGAGCAGGAGAGGCCGTTTGTCTGCAGTGCCCCAGGCTGCTCCCAG CGTTTCCCAACAGAGGACCATCTGATGATTCATAGGCACAAGCACGA

GATGACTTTGAAGTTCCCTTCAATAAAGACAGACAATATGCTGTCAG ATCAGACTCCGACGCCCACAAGATTCCTGAAGAACTGTGAAGAGGTGGGTCT

CTTCAGCGAGCTGGACTGCTCCTTTGAGCACGAGTTCAGGAAGGCTCAAGAGGAAGAGAACAGCAAGCGG CCTGGCTGGGAGGAAACACCCTTTGACAG

TGATAATGGAGACGACAACCTATTCCTTCCCCCTCCACGGTGA
Translation
 MNLEQERPFVCSAPGCSQ RFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSD DQTPTPTRFLKNCEEVGLFSELDCSFEHEFRKAQEEENSKR PGWEE

TPFDSDNGDDNLFLPPPR
Transcript ENSMUST00000114409
Sequence
AGTCCAACGTGGTCCCTTCACCCGGGCTCGGCTCTTGCCTTCTCCACACTTGTTTG ATTTATGAGGAATCCAAGATGAACTTGGAGCAGGAGAGGCCGT

TTGTCTGCAGTGCCCCAGGCTGCTCCCAG CGTTTCCCAACAGAGGACCATCTGATGATTCATAGGCACAAGCACGAGATGACTTTGAAGTTCCCTTCAA

TAAAGACAGACAATATGCTGTCAG ATCAGACTCCGACGCCCACAAGATTCCTGAAGAACTGTGAAGAGGTGGGTCTCTTCAGCGAGCTGGACTGCTCCT

TTGAGCACGAGTTCAGGAAGGCTCAAGAGGAAGAGAACAGCAAGCGG AATATCTCCATGCATAATACAGTTGGTGGGACCATGACGGGACCCGGAGCTC

ACCAGCTAGGCAGCACTCGGATGCCCAACCATGACAGCAGCGTTGTGATTCAGCAAGCCATGCCTTCTCCCCAGTCCAGCTCGGTCATCACTCAGGCTCC

TTCCACCAACCGCCAGATTGG - UNI14854 - GCCTGTCCCAGGCTCTCTATCATCTCTACTCCATCTCCACAACAGACAGAGGCAGCCCATGCCGG

CCTCCATGCCTGGAACCCTGCCCAACCCCACCATGCCAGGATCTTCTGCCGTCTTGATGCCT ATGGAGAGACAGATGTCAGTGAACTCCAGCATCATGG

GCATGCAAGGTCCAAACCTCAGCAACCCCTGTGCTTCTCCCCAAGTCCAGCCAATGCATTCAGAAGCCAAAATG AATCTTCACCGTCCCTCACCCTTGG

CTCTGTGTCTTCATAGCTAGCAGCAGGAATTCAGACCCTGAGATGTACACATTACACAAACACAATATTTCCTTGTATACTTGCTGTATGCTAGTTCAAC

AGGGGTAGTTTCTTTCTGTAGTTTGCTTTTAAAGACAGGTTACTCTTGATTAGGGGGTTGGGGTAGGGAGAAAATTGTCTTCAAGACTGTAAAGCCCTCT

GGCTTGTCGTTCCACTGGCATCCAGCATCAGTCAAGTTTCCCAGGAACTTAAATGTATTTCTCCTGGTATCTTCAACTGCCCTTTATCCCCCCTGTGTCT

TTTCAGGGAAGCTTTCAATAGGTATCCCAGGTTGGCTTCAAACACTGGATCCTCTCTCTCCTCAGCCATCCCAACCCTGAGATTATAGGCATGTGCCACC

ATGACCAGATTCCTATCACACCTTCACCTTGACAAGGCATCTATCTCTTTGCCCTGCACCTCTCTTTCTGACTGCCTTGTTACTTACAACATAAACCTGG

ACACAAGAAGGGTCTTTGAATATAGTCAGCAACTCTTAGCAATTCTTGTAAATTATCATGTTTCTAGTTGGCTGGTTTATGGAAGGTATTTTTTCATTGG

AGATGTCTCAAATTTTTTTCTCTTACTGATGGAATTTGAAAATGTTATGTAGTCAGGGTGTAAAGATTGCTTAATTATAATTGTGAGGTAATTACATTTG

TGAAGCTAGAAAAAGTCTCCTTGCATGACCACCCAATGGGTAGACGTCATTTTTTTTTATTGACTCAAATTCTCCCTTGAAGTTTAATAACATCCTTGCT

TATCATTGATTATTTTAAAAATCTCTAATTTGAAATAAAATATGTGCTATTGACATTATAATAAGATGCACACTGCTATACTTAAGCCATGCTAGAGTGC

ATAGTGTGAGGGGAGAGGATGCTGGATTCTCCTCTATAAAGGCTCACAGAGAAGGCTGCACTTGCTGTGACTCACACATCCCACCCCCACACTAACATTT

GTACTTTTAATCTTTGAAAGTAGCCTTTTGGGTTTTGGACAGCAAACTCAACACTTTGCCAAGCTATAAAATTCATAACGTTTAAGAGAAAGATCAAACT

AAAAGGAGGGAGTTTATATGTACAAATATTTACTTAGTGGAAATATTCCTGTTGGATGGCCTCCCGCTGCCTGATTCTGGTGCATTAGAAAGTCTGAGCT

ATAATTTATTTGTTTTCTCATTTTTATATTATGCTTTTCCAATTTTTAAAACTTTATAAAAGTTATTGCTTTGTAGAGATACTATCTATCTGCCTATCTA

TCTGCCTGAGACTGACTGTAGATTTTTGCCAAAAAAAAGGACTAGTTATATGTTTTCAAAAGTAACTGAAGACTTAGTCCTTTTTTTCCCTAGAGTCTAA

TTGTAAATTCTAGTGGTGGTAATTTCAGTTTCTGTAGTGGTTAAGAACTCATTTCTAGGGATGATGAGATTTTTAAAAAGACATTTTGTTGATATCTCAT

AAATCAACTTCAGCCACGTCTCAGTCTGTCTGTTGAATGTGCCTTCACACAGTCCTTCAGAGGTATAAATAGCAAGGAGTCTATAGTCAGTCAAATCTCA

CTTTTACATAGCCATGAATATTGTCATCAAGATAATGACAAAGAGCTGCTCACCTTATTTTTGTTCACGTAGATGACATTGGTCTGATTTGGAATTATAA

AACATTGCAGAAAATTCCAAATCAGGCTTTATCCAGCTAGTCTTTGGATATGCTATCTCTGAGAACCTCATGGGTTATGATGGAAGATGTATGCAAAGTG

AGAAGAGGGAACCGAGGATGGACATGTAAAGATTTAGATGTCTTGCTTTATTTTTTGTTTGGTTGTTCCTTTTCCAATGAAAGCAAATGTCATCTAATCA

CATTTCCCTGACCCATAACTTTGTGTCTATGTCCTTTATATTTTTCACTTTTATGGATCCCTGACATGGGTAGACAAGAAAAGACAAAGGACAATGAGTT

GATGGTGGTGGAAAATTAGTCCTGGCACTGAGAAGGGGGTCAGAGGAATGAAAGTGGAGAGTTTGTAGAAGGGACCACCACCTTATGTCAAGCCTCCTCT

CAACACAGTGTCCAGAATGACTGCTACTGGACTGTGCAGGAAGCCGGGCGCTATATTCACATTGTAGTGGCCCTCACCACTGAACATTTCCTCGGGTAGA

AATCACACTGGGGCAAGTTCAACAAAGGTTACTTAGACCTCCTGGGGCCACAGCTTTTCCGAGATATAAACGGAAATCCTAATGTATACTAAATAAGAGG

ATACATAGTTAGGTTTTAGTATATAAATAAATATAAATATTTATGCATTAGTCCTTTCCCACTGCACTATAAGAATTTCAGGTGTTGGCTTAGCCAGTGT

GCTGTTGACTGCATGTTATGCACCAGCTCCTTAAAGTTATTTGAAAATCAAGAGCTGAACAAACAAATAGTCTGACAAAAAGGAAATATTGATTTTTTTC

CATATCCCAAGATTTATGTTAAATTCCCCCCTTGGTTCTTGGTGAAATGTCTACATAGCCCTATCAAGCTGTGTCTGGCTCTATATCCAGAAAGCACAAG

AGAGGTTACGTCTAGTAGACAAACATCTGAGCCCTCTGTAAGACTTCACTTCCAGGTAATGGCTGCCCCAGCAACTCAGATGGAATGGCCTCTGTGTCTA

CCTAAGCTTAAAGAAGCCTTTAAGAAGGAAGAGTTCCTCAGACTCCATGTTAGCCAGACTCTTCGCCACTAGTACACAGTAAAAATGGAAGGATGAAATT

CATAGCAAAGAGTTCTATCTCTGGGGCGTTCTTTGGAGACAGACTATTTCCTGTTCTTTGAGCATTGGTAGATCATGAAGTTATTACAGGGCGTCAGAGC

ACCTGTCAAACTCAGAAATGGACACAGAATATGTTTTCAGTCCTGGTGTCTACTTTTCCATCTCTTGCTTGTAGGGTTTCTCTTTAATAAGACAAGGCCA

GGTCCAATCCATGCAGGGAGAAAACTTCTAAGAAAGCCATCTGGAACTCTGTTTTGCTTGCCTCTCATGACAACTTTTACAGAGTCAAATGATGTCACCC

TTGAGCTGTGCATTCCCATCACCTAACCCCTTTTCAGATCTTGCTGCCCCCTCTTTATTGTCACTGTGACTATGTATACCAGACTAGCTGCCCCCAGTAT

ATCACAGGTAGGTTTCATAGAGCACCTAGGAGAGAGAGAGGGGGAAAGCTGGGGAGCATGAGAGCCCCTTCCATAAAGTCCTGACATGAATTCCTTTACT

GAGCTTCATCCTGTCCTTTCAGGAATTTTTCTATTGGCCAAATCTTAGCAAAGTTGGGTGTAGTTTTAACTCAGCAGAACTTCTGTTTGGAGATATTACA

GAGTGACCATTTCACTAGAATCTTCCTAAAGACCCCACCATGAAACTCACCTATCATTTGCCTAAGTATTCCACAGTGAGCCTGGAGGACTTTTGCAGAG

ACTCCGGAGCACATTCTCTCAGAGTTCCCTCCTGTAAGCGGGCACACGCCTGTTCTGCGGCCCTCAGTTTAGGTCCTGGTGGTGGGTATCAGGAAAGCCA

GCTAAAGCAGAAAGCTGAGAGTTCATATCGTCTTGATCAATCACAAATACATAGTAGAGGCAGCCACTGAAGTGGCATGGGTCTTT
Translation
 MNLEQERPFVCSAPGCSQ RFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSD DQTPTPTRFLKNCEEVGLFSELDCSFEHEFRKAQEEENSKR NISMH

NTVGGTMTGPGAHQLGSTRMPNHDSSVVIQQAMPSPQSSSVITQAPSTNRQIG - UNI14854 - GPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPT

MPGSSAVLMP MERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKM NLHRPSPLALCLHS
Transcript ENSMUST00000101392
Sequence
CAGATTTATGAGGAATCCAAGATGAACTTGGAGCAGGAGAGGCCGTTTGTCTGCAGTGCCCCAGGCTGCTCCCAG CGTTTCCCAACAGAGGACCATCTG

ATGATTCATAGGCACAAGCACGAGATGACTTTGAAGTTCCCTTCAATAAAGACAGACAATATGCTGTCAG ATCAGACTCCGACGCCCACAAGATTCCTG

AAGAACTGTGAAGAGGTGGGTCTCTTCAGCGAGCTGGACTGCTCCTTTGAGCACGAGTTCAGGAAGGCTCAAGAGGAAGAGAACAGCAAGCGG AATATC

TCCATGCATAATACAGTTGGTGGGACCATGACGGGACCCGGAGCTCACCAGCTAGGCAGCACTCGGATGCCCAACCATGACAGCAGCGTTGTGATTCAGC

AAGCCATGCCTTCTCCCCAGTCCAGCTCGGTCATCACTCAGGCTCCTTCCACCAACCGCCAGATTGG - UNI14854 - GCCTGTCCCAGGCTCTCTA

TCATCTCTACTCCATCTCCACAACAGACAGAGGCAGCCCATGCCGGCCTCCATGCCTGGAACCCTGCCCAACCCCACCATGCCAGGATCTTCTGCCGTCT

TGATGCCT ATGGAGAGACAGATGTCAGTGAACTCCAGCATCATGGGCATGCAAGGTCCAAACCTCAGCAACCCCTGTGCTTCTCCCCAAGTCCAGCCAA

TGCATTCAGAAGCCAAAATG AGACTGAAGGCTGCGCTGACTCACCATCCTGCCGCCATGTCGAACGGGAACATGAGCACCATCGGACACATGATGGAGA

TGATGGGCTCCCGGCAAGACCAGACACCGCACCACCACCTGCACTCACACCCGCATCAGCACCAGACACTGCCGCCCCACCACCCCTACCCACACCAGCA

CCAGCACCCCGCACACCATCCCCACCCACAGCCTCACCACCAGCAGAACCACCCGCACCACCACTCCCATTCCCACCTTCACGCACACCCGGCGCACCAC

CAGACCTCGCCACACCCACCCCTGCCCACCGGCAACCAAGCACAG GTTTCACCAGCTACACAACAGATGCAGCCAACCCAGACAATACAACCGCCCCAG

CCCACAGGGGGACGCCGGCGAAGAGTGGTGGATGAGGACCCAGATGAGAGGCGGAGGAAATTTCTGGAAAGGAACCGGGCCGCCGCCACCCGCTGCAGAC

AGAAGAGGAAGGTCTGGGTGATGTCACTGGAAAAGAAAGCTGAAGAGCTCACCCAGACAAACATGCAGCTTCAG AATGAAGTGTCCATGTTGAAAAACG

AGGTGGCCCAGCTGAAGCAGTTGTTGTTAACACATAAAGACTGTCCGATAACAGCCATGCAGAAAGAATCCCAAGGGTATTTAA GTCCAGAGAGCAGCC

CTCCTGCGAGCCCTGTGCCAGCATGCTCTCAGCAGCAAGTTATCCAACACAACACCATCACTACATCCTCATCGGTCAGCGAGGTCGTGGGGAGCTCCAC

CCTCAGTCAGCTTACAACTCACAGAACAGACCTGAATCCTATTCTTTAAAAGGCATCGGTCAAACCTGGCCTTTGAGAAGAGCTGTAGCATGCCGTACAT

CCTTTCTCAAAGGGGCATTTTTTTTAGAATTATCTCAGACCTGGAAGACGCCTCAGCCCTTCAAAGACTGGCTTTCATTTTTATAGTTATTATGGAAATG

TTGTCTTTTATACTTAGTTATATAAGAAAAAAGGGAGATATGCAATGAATATCTATCAGCTTGGGGAGCACGTTGGTGCTTCTCTGCAATTTTCTGGTAC

CAGTTTCTTGTTTATAAACGGAACCTTTCCTGTATATAGCCATGGTTTCATTCTTACCAGCCCAACCCTTTGCCTGGAACAATGAATCTTGTTCAACTAC

AGCTTTTAGCCAAAATGAGGTATGCTTAGATGTCAAGCGAGATGGATCCACACAGTAACTGGGTGGGAAAGCTCATGATGTCATAACTCATGTTGAGTTT

GTGCTGTGATGTCACCAGAATCTCAGATAAACACATGGGCCTTCCTGAATATTTTTTTCTCTTGCTAGAAAAAAATAAATTATGGTCCATCCATATCCCA

TGAAAGCCACCAAGCATCTCAGGCCCCCTCCTTCCTCTCTTTTCTACTTGCGCAGATGTCCAATATCCATCTCATTTTCCTTTCCCCGGATCCCTTGTTT

ACTCTTTGTTTTGACTTTTTTTCTGTTTCCTTTTCTCCCCTTTAGCTTTGCATGTAAAAAAGAAAATAATGTTTAAAGAAGAGAAAAAGCAAATCTGGAA

ACTGTGGACCTAGCCACAGTTTAACCCACAGCTGGAGTTCATTCAATTTTTGCCTTTCACAAAATAGCAACCAGGAGATGTTTAATGTGCCTGATTTAAT

GTTTTTAATAACCAGAGCAAATAAAAGGTGGTTTGGTTATAGGTGAAGCACTGTTGAATGCCAGCTGTGGGGACACTAGGGAAAGGGACTTCGTAAGCTC

CAACTGTGAAAATTCAAATAAGGATGTGGGCTCTAACATCACACCCTCGAATTACAGCTCGCTTCTATGGCCTGTCTATAATGTAAAAAATCCATGCACT

ATATAATAGTTCAGAAGGGCTCTGTTCACTACACAGATTACATTGTTCAATCATCAGCTGCTAATAACCTAAGATTTATTATTATTATTTTTCTTAAGCC

TATGGAACCAGCTCTGCTGTTCTGGTGGGCAAAAGCAAACTCACTCTTGGAGCAACAGAGAGAAAGCGAGGCCAGCGTTTCTCGGGGACTCGCAGTCTGC

CAGAACAGTCAGACTCCTTGGCTGCTGACCGAGTCCCATGGAGGTGGCCAGGCTGGTGCGCTCATCTGAGTAGTTCTGATTTATATTTTCAGCAATGTCC

ACGGACTTGCCCATTACGGAAAGCAGATCAAACCCAAACCACAGTTGTGCCTCCTTGAAACAAGCCATTCTACTCTGCTGGTGTTTTACTATCGTGTTTC

ACAAATAATAGGGGCTAATGTTTCTCACTAGCAGTCTGGGCATATGCTGGTGTTTCATCTCTGCCCAAATAATTCACCTCCTAACCTATGTGTGTGTGTG

TGCACATGGATGTGTGTGCCTGAGTGTGTGAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTTATGAACAGTATAGGTTTTAAAAGAACA

GTATTTTACAAAAGCCATCACTTTTATAAGAGTTCTGTAAAGGAAGGATGTACTTCTTCGCTCACTATAGTTTAAAAAAAATTCTATTTTAGAGG
Translation
QIYEESKMNLEQERPFVCSAPGCSQ RFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSD DQTPTPTRFLKNCEEVGLFSELDCSFEHEFRKAQEEENSKR

 NISMHNTVGGTMTGPGAHQLGSTRMPNHDSSVVIQQAMPSPQSSSVITQAPSTNRQIG - UNI14854 - GPVPGSLSSLLHLHNRQRQPMPASMPG

TLPNPTMPGSSAVLMP MERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKM RLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPH

QHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLPTGNQAQ VSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERR

RKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQ NEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLS SPESSPPASPVPACSQQQVIQ

HNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL

For any suggestions or comments, please send an email to unitrap@crg.es