Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053062 (Jam2)
Chromosomal location
Chr 16: 84774368 - 84826173 (+)
Description
junction adhesion molecule 2 Gene [Source:MGI (curated);Acc:Jam2-001]
RefSeq_dna
NM_023844 
RefSeq_peptide
NP_076333.3 
UniGene
Mm.41758 Mm.380982 Mm.395117 Mm.397939 Mm.401447 
MGI
MGI:1933820 
Uniprot/SWISSPROT
Q9JI59 
Uniprot/SPTREMBL
Q9CWD9 A6X955 
Human Ortholog
ENSG00000154721 (JAM2)
Omim not available
UniTrap UNI243
Vector Insertion
Chr 16: 84774367 - 84774799
Public Clones GC0388 (tigem) RST515 (baygenomics) P024D02 (ggtc) W173C05 (ggtc)
W203C08 (ggtc) G026D05 (ggtc) P078B01 (ggtc) P012G01 (ggtc) Q017A02 (ggtc)
P111H12 (ggtc) P090D09 (ggtc) G004D03 (ggtc) P068E05 (ggtc) Q020B05 (ggtc)
G038A09 (ggtc) D007B12 (ggtc) G074A03 (ggtc) G057F02 (ggtc) M124A10 (ggtc)
P082F01 (ggtc) G007C04 (ggtc) P066B02 (ggtc) Q009D05 (ggtc) M058C08 (ggtc)
G064A07 (ggtc) P089C05 (ggtc) W203D08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37936
Vector Insertion
Chr 16: 84774630 - 84774799
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16134
Vector Insertion
Chr 16: 84774799 - 84801814
Public Clones (sanger) E324H09 (ggtc) E127B02 (ggtc) E038A11 (ggtc) D176E02 (ggtc)
D136G01 (ggtc) D121G05 (ggtc) D063G10 (ggtc) P150H06 (ggtc) E324F03 (ggtc)
E100D02 (ggtc) D187B03 (ggtc) D156C09 (ggtc) D133G03 (ggtc) D096A02 (ggtc)
D029F08 (ggtc) E325F07 (ggtc) E132A07 (ggtc) E079B12 (ggtc) D186G09 (ggtc)
D154B07 (ggtc) D122D07 (ggtc) D077C06 (ggtc) D007B12 (ggtc) P098H01 (ggtc)
E113E08 (ggtc) E001F09 (ggtc) D165F11 (ggtc) D046B03 (ggtc) E087H04 (ggtc)
D187B01 (ggtc) D131A07 (ggtc) D088G05 (ggtc) D008B05 (ggtc) E325C10 (ggtc)
E128B10 (ggtc) D138C11 (ggtc) D005G11 (ggtc) E324G03 (ggtc) D113G01 (ggtc)
E132D01 (ggtc) D186H09 (ggtc) D122D11 (ggtc) 5SD186F09 (ggtc) CMHD-GT_477C9-3 (cmhd)
PST22115-NR (escells) PST23743-NR (escells) IST13452A11 (tigm) IST11648C7 (tigm)
IST13116H12 (tigm) IST10731E6 (tigm) IST11994D6 (tigm) IST12970E11 (tigm)
IST13125A3 (tigm) IST13086C10 (tigm) IST13110G9 (tigm) IST14947H8 (tigm)
IST11452B10 (tigm) IST10408H12 (tigm) IST14134A2 (tigm) IST10490G8 (tigm)
IST11184H6 (tigm) IST12601G4 (tigm) IST12183A8 (tigm) IST12015B9 (tigm)
IST12883G2 (tigm) IST11847G7 (tigm) IST12427F2 (tigm) IST13121F7 (tigm)
IST13069B3 (tigm) IST13125A5 (tigm) IST13117A11 (tigm) IST13100G5 (tigm)
IST14543G8 (tigm) IST12589B7 (tigm) IST12522D4 (tigm) IST14980A2 (tigm)
IST13089A9 (tigm) IST11799E12 (tigm) IST13121C4 (tigm) IST11914E11 (tigm)
IST13105C8 (tigm) IST13091C3 (tigm) IST13073E3 (tigm) IST10818E5 (tigm)
IST12596F8 (tigm) IST10807C2 (tigm) IST11499E6 (tigm) IST13105A7 (tigm)
IST13112G4 (tigm) IST11530C9 (tigm) IST14961E4 (tigm) IST14153B6 (tigm)
IST11174G5 (tigm) IST12130H1 (tigm) IST13130C9 (tigm)
Private Clones OST466157 (lexicon) OST465402 (lexicon) OST444083 (lexicon) OST442208 (lexicon)
OST436465 (lexicon) OST436033 (lexicon) OST425078 (lexicon) OST422612 (lexicon)
OST401540 (lexicon) OST389673 (lexicon) OST381341 (lexicon) OST374100 (lexicon)
OST359320 (lexicon) OST332417 (lexicon) OST327063 (lexicon) OST315342 (lexicon)
OST309395 (lexicon) OST286494 (lexicon) OST281411 (lexicon) OST276379 (lexicon)
OST267964 (lexicon) OST262313 (lexicon) OST262197 (lexicon) OST202508 (lexicon)
OST201560 (lexicon) OST198791 (lexicon) OST195236 (lexicon) OST170007 (lexicon)
OST157738 (lexicon) OST136387 (lexicon) OST135238 (lexicon) OST130739 (lexicon)
OST123088 (lexicon) OST96556 (lexicon) OST72660 (lexicon) OST68527 (lexicon)
OST66533 (lexicon) OST65057 (lexicon) OST57042 (lexicon) OST56760 (lexicon)
OST47345 (lexicon) OST42979 (lexicon) OST39661 (lexicon) OST37749 (lexicon)
OST37225 (lexicon) OST36638 (lexicon) OST34804 (lexicon) OST33008 (lexicon)
OST30532 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13358
Vector Insertion
Chr 16: 84774799 - 84801814
Public Clones CMHD-GT_332F5-3 (cmhd) FHCRC-GT-UAS-2H5 (fhcrc) FHCRC-GT-S1-8E1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10795
Vector Insertion
Chr 16: 84801884 - 84807079
Public Clones (sanger) P027B04 (ggtc) P122E11 (ggtc) G057B03 (ggtc) CMHD-GT_524G7-3 (cmhd)
IST12645C3 (tigm)
Private Clones OST409725 (lexicon) OST382333 (lexicon) OST333211 (lexicon) OST318899 (lexicon)
OST306561 (lexicon) OST280915 (lexicon) OST254712 (lexicon) OST242455 (lexicon)
OST239173 (lexicon) OST233132 (lexicon) OST198969 (lexicon) OST198840 (lexicon)
OST130413 (lexicon) OST99240 (lexicon) OST68282 (lexicon) OST58238 (lexicon)
OST52558 (lexicon) OST35449 (lexicon) OST32105 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10718
Vector Insertion
Chr 16: 84807188 - 84809588
Public Clones 5SE305H01 (ggtc) H002G08 (ggtc) 3SE305H01 (ggtc)
Private Clones OST189087 (lexicon) OST169610 (lexicon) OST130354 (lexicon) OST78071 (lexicon)
OST70439 (lexicon) OST38673 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19411
Vector Insertion
Chr 16: 84809588 - 84809742
Public Clones not available
Private Clones OST391673 (lexicon) OST361795 (lexicon) OST133900 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13464
Vector Insertion
Chr 16: 84811242 - 84813143
Public Clones CMHD-GT_247B10-3 (cmhd) CMHD-GT_246B2-3 (cmhd) CMHD-GT_247G03-3 (cmhd) CMHD-GT_247B6-3 (cmhd)
CMHD-GT_272E5-3 (cmhd) CMHD-GT_247B5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13466
Vector Insertion
Chr 16: 84813344 - 84815413
Public Clones CMHD-GT_247E04-3 (cmhd)
Private Clones OST327284 (lexicon) OST283410 (lexicon)
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17269
Vector Insertion
Chr 16: 84815514 - 84816510
Public Clones not available
Private Clones OST446283 (lexicon) OST446275 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13463
Vector Insertion
Chr 16: 84819021 - 84821504
Public Clones CMHD-GT_247D06-3 (cmhd)
Private Clones OST321787 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29116
Vector Insertion
Chr 16: 84821548 - 84823031
Public Clones not available
Private Clones OST8377 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057513
Sequence
AGGGCCAGAAGACCTGCCCCCACGACAGTCGCTGGAGACACCCCAGACCGGAGAGACTGACATCGGGACAGGACCCGCCCCTCTGCTTCCACCTCTCAGG

GACCTCCTCTGCTCCGCCGCCGGGCGAAGTGCTGGGAGACCCAGCCGCCTGTCGCGCTCCTGCAGGGGGACCCTCAGCTAGGCAGCCAGCTGGCGCCCGC

GTAGATGGCGAGGAGCCCCCAAGGCCTCCTGATGCTGCTGCTGCTACACTACTTGATCGTCGCCCTGGACT - UNI243 - - UNI13358 - - UN

I16134 - ATCATAAGGCAAATGGGTTTTCTGCATCAAAAGACCACCGTCAAGAAGTCACAGTAATAGAGTTCCAAG - UNI10795 - AGGCTATT

TTGGCTTGTAAAACCCCAAAGAAGACTACCTCCTCCAGACTGGAGTGGAAGAAGGTGGGACAGGGGGTCTCCTTGGTCTACTACCAACAGGCTCTCCAAG

 - UNI10718 - - UNI19411 - GTGACTTTAAAGACCGTGCTGAGATGATAGATTTCAATATACGAATCAAAAATGTTACAAGAAGTGATGCTGG

AGAGTATCGCTGTGAAGTCAGCGCTCCGACTGAGCAAGGCCAGAACCTGCAGGAAGATAAAGTCATGCTAGAAGTACTAG - UNI13464 - - UNI1

9411 - TGGCTCCTGCTGTTCCTGCCTGTGAAGTGCCCACTTCTGTTATGACTGGAAGTGTGGTGGAGCTACGATGCCAGGATAAAGAAGGAAACCCAG

CTCCGGAGTACATCTGGTTTAAAGATGGCACAAGTTTGCTAGGGAATCCAAAAGGCGGCACACACAACAACAGCTCGTACACAATGAACACGAAGTCTGG

AATTCTG - UNI13466 - CAATTCAACATGATTTCCAAGATGGACAGTGGAGAGTATTACTGCGAAGCCCGGAACTCTGTCGGACACCGCAGGTGCC

CTGGGAAGCGAATGCAAGTAG - UNI17269 - ATGTTCTCAACATAAGCGGCATCATAGCAACGGTTGTGGTGGTGGCCTTCGTGATTTCTGTATGT

GGCCTTGGCACATGCTATGCTCAGAGGAAAGGCTACTTTTCAA AAGAAACTTCCTTCCA - UNI13463 - GAAGGGCAGTCCTGCATCTAAAGTCA

CTACGATGAGCGAAAAT - UNI29116 - GATTTCAAGCACACAAAATCCTTTATAATTTAAAAGAATTCCAGTTTTGAGCTGCACCAAAACCAGTTG

TCACATGTTATTAAAATATTGTAAAACT
Translation
MLLLLHYLIVALDY - UNI243 - - UNI13358 - - UNI16134 - YHKANGFSASKDHRQEVTVIEFQE - UNI10795 - EAILACKTPK

KTTSSRLEWKKVGQGVSLVYYQQALQG - UNI10718 - - UNI19411 - GDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQGQNLQEDKV

MLEVLV - UNI13464 - - UNI19411 - VAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSYTMNTKSGIL

 - UNI13466 - QFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVD - UNI17269 - DVLNISGIIATVVVVAFVISVCGLGTCYAQRKGYFSK 

KETSFQ - UNI13463 - QKGSPASKVTTMSEN - UNI29116 - DFKHTKSFII
Transcript ENSMUST00000098407
Sequence
CTCCTCTGCTCCGCCGCCGGGCGAAGTGCTGGGAGACCCAGCCGCCTGTCGCGCTCCTGCAGGGGGACCCTCAGCTAGGCAGCCAGCTGGCGCCCGCGTA

GATGGCGAGGAGCCCCCAAGGCCTCCTGATGCTGCTGCTGCTACACTACTTGATCGTCGCCCTGGACT - UNI243 - - UNI13358 - - UNI16

134 - ATCATAAGGCAAATGGGTTTTCTGCATCAAAAGACCACCGTCAAGAAGTCACAGTAATAGAGTTCCAAG - UNI10795 - AGGCTATTTTG

GCTTGTAAAACCCCAAAGAAGACTACCTCCTCCAGACTGGAGTGGAAGAAGGTGGGACAGGGGGTCTCCTTGGTCTACTACCAACAGGCTCTCCAAG - 

UNI10718 - - UNI19411 - GTGACTTTAAAGACCGTGCTGAGATGATAGATTTCAATATACGAATCAAAAATGTTACAAGAAGTGATGCTGGAGA

GTATCGCTGTGAAGTCAGCGCTCCGACTGAGCAAGGCCAGAACCTGCAGGAAGATAAAGTCATGCTAGAAGTACTAGGTACAGCACACACATATGTAACG

GCTGCCAGCTGTCCCGTCCTCGTCCCCCAGCCCCGCGGAAAGATTTTGGCTTTGTTTGTTTTTCAGCAGCCTGGATGGTATTACATAAGTTTCCTGTCTC

TCCTCTCCCTTTCATCTTCAGTCTAACAGAGGCATACTGGATCCTTTTTGTACTTTGAATTACTAGACACTTCCTTCGGTAATTAGCCAGCGTGAACCCT

GAATTTTAAAAGTCCATGCTAGGGTCTGGAAAAATGGGCCAGCAGTGGTTAAGAGCATTTGATGCTCCTGCAGATGACCCAGTTTGTCCCAAGGTCATTT

CCCAGCATCTACATGGTGGTTCAGAAACTTCTGTCACTCCAGGTCCTGAAGATCTTCTACCCTCTTCTTCTGACTTCCATTCGCATTCCATGCATTCGGG

GCATATACATACATTCAGGTAAAACATTCATACACATTAAATATACATAAATAAATCATTAAAGCCACCATGTTGTGTGGTCATATCCACATTTCTATAT

TACCGAGAATGGATTTGAAATCTTAATTATATCTTCCAGATTTCTTCATAGTACTTTATAAATATAATCTTATATAAAATATATAAATATAATTTTAAGT

ACTGAGAGACCATGCATGTATACTGAAGATGGGAATGTTGTGGGACTGCCAGGATTCTGCCTACCATCTTCAGTCCTGAATTTTCAAGGAGATTATTAAT

AGTTATCTACGGTCTTACTTAGGGTTTTCTTGCTGTGAAGAGACATCACGGTCATCCAACTCTTTGTAAGGGAAAGCATCTAATTGGGGCTGGCTTATAG

GTTCAGAGGTTCAGTCCATTTATCATCATGTTGGGAAGCATGACAGCATCCAGGCAGACATGGTACTGGAAAAGGAGCCAAGAGTTCTACATCTTAATCC

ACAGGGAGTAGAAGGAAACTATGTGTCATACTGGGTGACCTCAAAACCCACCCCCACAGTGACACACTTCCTCCAACAAGGCCACACCTACTCCAACAAG

GCCACAACTCTTAATAATGCCACTTTCTATGGGACAAACATTCAAGCACAGAGTCTGTGGAGATCATTCCTATTCAAACCACCACACCCACTACATTCTA

TTTTAGTTCAAGTCTCTAAGACCCAATTTCCCCAATGAGACCCTTCTTTTTTCCTTTATTTAAAAAGTACTATATAATATAATATGATAAGATAAAAGAC

CCCACTTCTTAAAGTCTCCACAACCTCTTCGAAAACATCAAGAGCTGGAGACCAAGTGTTCAGACACATGAGTCCATGAGTCACTCCATATTCAGATCTT

ATTGTTCTGCTCCTGAGTTCCAAACACTCACGGATATTTAATAAGGGAAATCCATTAAGTCTAACTTCAAAAGTCACTAGTCTCATGGTTCACACCCTGT

TCTAAAGTCTGAAGTCTTAAATTGTTCAAGGCAATCGCTTAACTGTCAACCCTTATGTAATAAAATTTAAAAATAAT
Translation
MARSPQGLLMLLLLHYLIVALDY - UNI243 - - UNI13358 - - UNI16134 - YHKANGFSASKDHRQEVTVIEFQE - UNI10795 - E

AILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQG - UNI10718 - - UNI19411 - GDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQ

GQNLQEDKVMLEVLGTAHTYVTAASCPVLVPQPRGKILALFVFQQPGWYYISFLSLLSLSSSV
Transcript ENSMUST00000114195
Sequence
GTCTGGGGGCGGGGGGCCGACCTGCAGGGTTCTCCCTCAAGAGGCTAGTCCTCTGCCGCCACTCGCTTAGGACCCTGCGGACACCGCGTCCCGCGTCCAC

GCCCTCCCCTCAACCCTCTTCCACCCTTCAAAAGAAGGACTGTCCCAGACACCACGTCCTAGGGCCAGAAGACCTGCCCCCACGACAGTCGCTGGAGACA

CCCCAGACCGGAGAGACTGACATCGGGACAGGACCCGCCCCTCTGCTTCCACCTCTCAGGGACCTCCTCTGCTCCGCCGCCGGGCGAAGTGCTGGGAGAC

CCAGCCGCCTGTCGCGCTCCTGCAGGGGGACCCTCAGCTAGGCAGCCAGCTGGCGCCCGCGTAGATGGCGAGGAGCCCCCAAGGCCTCCTGATGCTGCTG

CTGCTACACTACTTGATCGTCGCCCTGGACT - UNI243 - - UNI13358 - - UNI16134 - ATCATAAGGCAAATGGGTTTTCTGCATCAAA

AGACCACCGTCAAGAAGTCACAGTAATAGAGTTCCAAG - UNI10795 - AGGCTATTTTGGCTTGTAAAACCCCAAAGAAGACTACCTCCTCCAGAC

TGGAGTGGAAGAAGGTGGGACAGGGGGTCTCCTTGGTCTACTACCAACAGGCTCTCCAAG - UNI10718 - - UNI19411 - GTGACTTTAAAGA

CCGTGCTGAGATGATAGATTTCAATATACGAATCAAAAATGTTACAAGAAGTGATGCTGGAGAGTATCGCTGTGAAGTCAGCGCTCCGACTGAGCAAGGC

CAGAACCTGCAGGAAGATAAAGTCATGCTAGAAGTACTAG - UNI13464 - - UNI19411 - TGGCTCCTGCTGTTCCTGCCTGTGAAGTGCCCA

CTTCTGTTATGACTGGAAGTGTGGTGGAGCTACGATGCCAGGATAAAGAAGGAAACCCAGCTCCGGAGTACATCTGGTTTAAAGATGGCACAAGTTTGCT

AGGGAATCCAAAAGGCGGCACACACAACAACAGCTCGTACACAATGAACACGAAGTCTGGAATTCTG - UNI13466 - CAATTCAACATGATTTCCA

AGATGGACAGTGGAGAGTATTACTGCGAAGCCCGGAACTCTGTCGGACACCGCAGGTGCCCTGGGAAGCGAATGCAAGTAG - UNI17269 - ATGTT

CTCAACATAAGCGGCATCATAGCAACGGTTGTGGTGGTGGCCTTCGTGATTTCTGTATGTGGCCTTGGCACATGCTATGCTCAGAGGAAAGGCTACTTTT

CAA AAGAAACTTCCTTCCA - UNI13463 - GAAGGGCAGTCCTGCATCTAAAGTCACTACGATGAGCGAAAAT - UNI29116 - GATTTCAAG

CACACAAAATCCTTTATAATTTAAAAGAATTCCAGTTTTGAGCTGCACCAAAACCAGTTGTCACATGTTATTAAAATATTGTAAAACTCTGTGTCTTACA

CTTGCAAAGTGATGAAGAAATATGAAAGTGGGAGTTCATCAGAAGTTTTATGATCTCTAACTCACAAGAAATATTTTAAGCAAAATGTTCTTGCCATCAC

TAAATTACAACCTGGCATCTTGTGTCTGACCTAAAGTGAAATGTCTGGTAATATTCTGAGTTTTTGAAGTGCAAATGAATGTCAGTTTGGAGTTGACTAT

ATCACACTGACTGTAAGGCTAATCCAAGAAGCAAGAATATACTCCATGTGTTCTCTCCATGCAAGAATGGCTTATGTGTTCAGGAAATACTCTAACGAAT

GGAAACCCTGTTCACAAAATTCCTACCAGAATCCTCTTCTTACCTCTAAATAACTTGGGTTCCATTGTCCTGTGTCTCTATATCCCAGGGCTGGGTCTTA

CGTCTAAGGATTTGCACTTTATATTTTCTTTCACTTCTCAGAACCAAAAGCAGCATGAAGGGAGCTGCTACTGCCATTTCCTTGGAGGCTTTTGGAGAGG

CTCAGCGACCTGGACATTAGAATGCATTACTAGAGCCTACACAACTCCACAGACACCCTTTTTGTGCTTGAGTGGTGACCTGTTATCTGTCTCTAAAAGC

AATTCTGAACTGGGCTAGTTCCTCCCCGGTGAAGATGAAGGGTTCCCAGTCAGCTTATGATGGAACAGGGGCACAGGGGAGAGAAGCATTTGCCCCATAA

GGCAAAGGTAGATGAACAAGCTCATTTTGACTCTTGATCCAGCAAAGGCACAGGAGAAACCATAGCTGAAATGAGATGGGTCTAATGTCTTCTGAACTGG

TTATCCACAAAGGCCACCAACCAGCTAGTGTCAGAATTGGAAATTCCCAGGGCTCAGCAGGAAACCCAGTCCTGTTGGGGACTACTTTACCCATATTAAA

ACAAACAAACAAACAAACAAACAAACATAAACGCAACCTGGGATGTCTAGTTCTGGGTAAATAAGCATGAAAGGTCATTTACTCCCTCTATCAGCTTTGA

ACATGGTCAAGTTGGCTTTGCACCCAAAAGGCAAGGCAGATTCTCAGGATTTGCAAACAGGGCAAGTGGTCAGAGAGTGCCTGGTATTGATCTGGTCACA

GGGGCGATGCCCACTGCCATAATCTTCCCCTTTAACTTTGTGGCCTTGAGTCCTTCCTAACCAGTAGACACCTTTCCAAAGGGCTGACTTGTGTAAAATG

GCTCAGCCCTCAAGCTCAGATTCACACTTGAGCTAGCAAGCTACAAGGAACGAGACAGTACATAATTCAACCCACATGGTTCTTGTTACAACCACTTAAT

GTAGAGTACAGGTAAGTGTGCCCACAGATCCAAGCTCCTTGCCCCTGGTAGCCAACAAACACCTGTGGTGTATAAGAAATCAGGGTAAATGTTGCCTAGG

CTGGGACTATGAGCTCTGCTTTGATAGGAGGACTGCTATCCTTCTGCAGTGCCAAGCAGACAGCTCTCAAGGATGCCTCTTCAGGCCCACATGCCTCTTC

AGGCCCACATAGCATCACAAGGCCCCTGCATCAATTTAAACGACACAATCCACCCCATGAGAGGACAGTTACGTAGTGCCTTACCTTCACTAACACATGA

GAAGCTTCCTTGTAAGACACTGAAGCCTAAAGGTTCACTTTATGCGGTGCGAACATCTAACAAAGTCTGTGCCAAACACCTATTATACATTCTTAGCTAA

GCTACTGTATACAGCCATGCAGAAATCATTGTATTAAGAATGCTTTCTTCTACACAAAGGACCTAACTGCACACTAATCTTCTAGTTATTAAGTCTATCC

GGGAGTCACTGCCATGAAGACCTGTCTGTCTGCTGTTTTCTGTGACTTGAACTCTAACAATGTGTCAAAATCTAATTGTAGTGTCTAGATGTTGATTTTA

TTTTTCCCGCAGTCAAAGTGCAGTAAGGGTCTAGAAACTATGTGAGCGAGTTTTGTTTTGGTACTGTTGCTGTTGTAACTAGATCCAGCTCATTTTTGGT

CGGGATAGGGGTTAACTCACTCAAGCACTAAGGCTGCATGTTTGTTTTCCAATACAACTTTACAAAGAACTTCCTTCACTCTACAACTCACTTTGTTTGA

TTAAAGTTCACGCTACAAAAATAGCTATGCACAGCTCAACGTTTTAGTCTCATTCACCGGAGGGGGAAGTCACTCACCTATTGTTCAATAACCCAGGAAA

CTCCTCCCTCCCTTCCACCTGCTGCTGTGAGGCAGCTCTAGCAGTTTAAAATCAAGTTTCACTTGTCTCTACGCTTGGATCCCGGCCAACTTCTAAAGTC

AGAGAACACAGAGGGTAAACTACTTACTGGCTGTTTTGTGTATGGCAGAGGTGGGGTTGAGGGAGTGCCAAATCTCCCTCCTCTTCCAAGACCTTGTGAA

GAAGAGCCTGCGGTGACCGCTTGCTTTGCAGTGCTGTGTTACTGGAGGAGCTGAACACAGCCACCAGATCCACAGCTCACACTTTCTTCACCCACCCCCA

TCCACCATGGTCCCCAAACCTATCTTTGTCAAACTTTAGCATTTAAAAAGAAAGATGCAACAGAATTTTATACACAACCAACCCAGGACCCACTTTTTGT

TTGTTGCCTTATTCAGCAAACTGAACTATGTTTGTCTTTACAATTTATTCTGCCCTTTTGTATACATTTGTACTACTTCCCCATCCATTAGTCCTCATCA

CAAGCTATGGAAATTCTATTTACTCCTGAAAGAGCAAATTCAACTCTCTGTGGGACTTCTCCCATTTTCCAGCTGTGAGTTTTGTCTCTGAATTCTGATG

GCATCTGATTCTTTTGTGATATTTATTGACTTCTGTGTTACAGTACCGGTAGGTATGTATATGTCTGACATCTCTACCAACCTGAAACCCTGAGAAAAGA

CCCATGTTGTACAGGTCTTCATAAACCCTAAGGTATTTAAGAGTATCTGAAAATGGTCAATACCTGTGAAACACAAAGATATTAAATATAAACATCTACT

TAGGAATTAATAAAACATTGTATTCTGATACAA
Translation
MARSPQGLLMLLLLHYLIVALDY - UNI243 - - UNI13358 - - UNI16134 - YHKANGFSASKDHRQEVTVIEFQE - UNI10795 - E

AILACKTPKKTTSSRLEWKKVGQGVSLVYYQQALQG - UNI10718 - - UNI19411 - GDFKDRAEMIDFNIRIKNVTRSDAGEYRCEVSAPTEQ

GQNLQEDKVMLEVLV - UNI13464 - - UNI19411 - VAPAVPACEVPTSVMTGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNPKGGTHNNSSY

TMNTKSGIL - UNI13466 - QFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVD - UNI17269 - DVLNISGIIATVVVVAFVISVCGLGTCYA

QRKGYFSK KETSFQ - UNI13463 - QKGSPASKVTTMSEN - UNI29116 - DFKHTKSFII

For any suggestions or comments, please send an email to unitrap@crg.es