Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053110 (Yap1)
Chromosomal location
Chr 9: 7931999 - 8004594 (-)
Description
yes-associated protein 1 Gene [Source:MGI Symbol;Acc:MGI:103262]
RefSeq_dna
NM_009534 
RefSeq_peptide
NP_033560.1 
UniGene
Mm.417311 
MGI
MGI:103262 
Uniprot/SWISSPROT
P46938 
Uniprot/SPTREMBL
Q3TUW1 Q91WL1 
Human Ortholog
ENSG00000137693 (YAP1)
Omim not available
UniTrap UNI581
Vector Insertion
Chr 9: 7973912 - 8001456
Public Clones CB0053 (sanger) BB0600 (sanger) BA0065 (sanger) BC0533 (sanger)
E036B02 (ggtc) D128H10 (ggtc) Q023C03 (ggtc) D188E09 (ggtc) (ggtc)
IST15045F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI68
Vector Insertion
Chr 9: 7962403 - 7973795
Public Clones GC0329 (tigem)
Private Clones OST427502 (lexicon) OST374110 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5357
Vector Insertion
Chr 9: 7953135 - 7962288
Public Clones (sanger) SYA411 (baygenomics) E118D10 (ggtc) IST11712D11 (tigm) IST14894E7 (tigm)
Private Clones OST332639 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35488
Vector Insertion
Chr 9: 7938407 - 7950540
Public Clones IST10378G5 (tigm) IST14652C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065353
Sequence
GTCTGGAGCCAAAGTTTCTGTCTCAGTTGGGACGCCGCCGCGGCCGGGGGCAAAGAAAGGGAGGAAGGAAGGAGCTCGCGGAGGGGAGGGGAGGAGAGGG

GAGGCGGCCTCGGGCAAGGAGTGCAGGGCGATGCGGGCGCGCGTCGCAGCCCCCCGAACCTGAGCGCAGTGCCCCGAGCGTCGAACGAGGCCGCAGCCAT

GGAGCCCGCGCAACAGCCGCCGCCCCAGCCGGCCCCGCAAGGCCCCGCGCCGCCGTCCGTGTCTCCGGCCGGGACCCCCGCGGCCCCGCCCGCACCCCCG

GCCGGCCACCAGGTCGTGCACGTCCGCGGGGACTCGGAGACCGACTTGGAGGCGCTCTTCAATGCCGTCATGAACCCCAAGACGGCCAACGTGCCTCAGA

CCGTGCCCATGCGGCTTCGCAAGCTGCCCGACTCCTTCTTCAAGCCGCCTGAGCCCAAGTCCCACTCGCGACAG GCCAGTACTGATGCAGGTACTGCGG

GAGCTCTGACTCCACAGCATGTTCGAGCTCACTCCTCTCCAGCCTCCCTGCAGCTGGGTGCCGTTTCTCCTGGGACACTCACAGCCAGTGGCGTTGTCTC

TGGCCCTGCCGCTGCCCCTGCAGCTCAGCATCTCCGGCAGTCCTCCTTTGAGATCCCTGATGATGTACCACTGCCAGCAGGCTGGGAGATGGCCAAGACA

TCTTCTGGTCAAAGATACTTCTTAAA - UNI581 - TCACAACGATCAGACAACAACATGGCAGGACCCCCGGAAGGCCATGCTTTCGCAACTGAACG

TTCCTGCGCCTGCCAGCCCAGCGGTGCCCCAGACGCTGATGAATTCTGCCTCAG - UNI68 - GACCTCTTCCTGATGGATGGGAGCAAGCCATGACT

CAGGATGGAGAAGTTTACTACATAAACCATAAGAACAAGACCACATCCTGGCTGGACCCAAGGCTGGACCCTCGTTTTG - UNI5357 - CCATGAAC

CAGAGGATCACTCAGAGTGCTCCAGTGAAGCAGCCCCCACCCTTGGCTCCCCAGAGCCCACAGGGAGGCGTCCTGGGTGGAGGCAGTTCCAACCAGCAGC

AGCAAATACAGCTGCAGCAGTTACAGATGGAGAAGGAGAGACTGCGGTTGAAACAACAGGAATTATTTCGGCAG - UNI35488 - GCAATACGGAAT

ATCAATCCCAGCACAGCAAATGCTCCAAAATGTCAG - UNI35488 - GAATTAGCTCTGCGCAGCCAGTTGCCTACACTGGAGCAGGATGGAGGGAC

TCCGAATGCAGTGTCTTCTCCTGGGATGTCTCAGGAATTGAGAACAATGACAACCAATAGTTCCGATCCCTTTCTTAACAG - UNI35488 - TGGCA

CCTATCACTCTCGAGATGAGAGCACAGACAGCGGCCTCAGCATGAGCAGCTACAGCATCCCTCGGACCCCAGACGACTTCCTCAACAGTGTGGATGAAAT

GGATACAG GAGACACCATCAGCCAAAGCACCCTGCCGTCACAGCAGAGCCGCTTCCCCGACTACCTGGAAGCCCTCCCTGGGACAAATGTGGACCTTGG

CACACTGGAAGGAGATGCAATGAACATAGAAGGGGAGGAGCTGATGCCCAGTCTGCAGGAAGCGCTGAGTTCCGAAATCTTGGACGTGGAGTCTGTGTTG

GCTGCCACCAAGCTAGATAAAGAAAGCTTTCTCACGTGGTTATAGAGCTGCAGGGAGCCACTCTGAGTCTGTGAGGGATCCACAGAGCCTAAGATGTGCA

CGCCTGAAATTCAGATAAGTCAGTGGGGGTTCTCTGGCTAACACAGAAAACAGATGAACCAGTGTCCATCGTTGTTCCGCTTTTCTCTGCCCGTCGCTGC

TCTTACGTTGGTTGCTGACCTCTTCACGGCCGGCTCTAAAGAACCCGAACCGCAGACAGATTCCTTTGTTAACTCTGCTATGATAACTACGTTCTCTGGG

ATTGCTGGGGGATGGCCTGCTGGATAATGGATGTTCTGCCTTTTGTCCGGTGGTCCTTTCACCATCACTTTAACTGAACACACAGACTGGGAACTGAATG

CTCTAGAACATTGTTCAAGAGGTGGTTTCTTCAGCTGCCTTGGGTCCAACAAGCCAGAGGCATTGCGTCTGATCTCGTGGAGGACGGAGGGGACCCACGC

TGAAGACTGGTGAACTTTCCATTCTTCTGTTAGCGATGCCGTTAGGCCATAGTGACCTGGGTCTTATCTTAGACGCTTATGAGGCATGAGACAGCTTCCA

TAGAAATATATTAATTATTACCACATACTCTAGATTAGGTTTGAATGAATATTTTCTGTGGGTGTTTTGGTTGGTTTTTCTCTGCCCCCCCCCCCTTTTT

TGTGGTTGGTCTTGGTGGAACGTAGGCAAATTAATGAATTCGTTTATAGCTGTAGCTTGGGGTGGGCAATACCATTCTTTTGGTGGGAAATCTGTATTTC

TTGGTTTTTTAACATCCTATTTAAATCTTAAATCTTGGTTATCTCCTCTCTACATATATACACACTCTTATTATGTCTATGGTAGTGTGATAGCAGAATA

TATCTTTATAAACATTTCTTTCCTTTCCAGTTTATTTTTTAAATGGTAGCCTTGAACATATACATTTAGACACAGTAGTTTATGTTTCACAAATACTTTA

AATTCTGGTTGGAGCAATTGCAGGTGTTTGAGGGAGGGTGGGCAGTGTTATAGAAAGGGCTCTAGTGGGTAAAGCCAAGAGGCGCCTCTTGCCCTCTGTG

CACTGTGGTGACAACAGAAGCCAACAGTGAGTGGCCTTACTTCCCTTAGCCTGATTTCATGCCATGTAGTGTCTGAGCTGTAAGCTTTAGAGAGGCAGGC

CTGCCTTCTGCCTCCACCTCAGCTTTGGGTGTACACTCAGATACTGAGACTGATAATCCACGAGGTCAGGTTGAGTGTCACCTACAAGATCATGCTTAGG

AAACCTCCTCCCGTGTCTGCTGAGTGGACCCTGGGGTAGTGTGCAGAATGCTGCGAGGTCATAGGTAAAGTGATCAGACTAGCAAGTGTGGGGTAGTTGG

ACTGAGCAGAGCTACAATGAAGCATGATTATGGCTTTATTTTTGCAAGATTACTAGAGTATGTGTCTCCAGGAGTAATAATGGTTTCCAAAGAGTATTTT

TTAAAGGAACAAAATAGGCATGAATTAACTCTGTGTATAAGCTATGAAGTAATAGTTGGTTATGAATTATAGTGGCACCAGCTAGCACCTCTGTCATTTA

AGGGTCTTTGAGTGCTTCTAGAAGAATCCCTTATTTTCAAGGGTTCATAATGAACAACAATTTTCCCCCCTGGCTAAAGCTGCTACTATAAAATCCTCAG

CTTAGGAAGATAGAAATCTTTTGGCCCTTTGATTTAGTATAGCACAAGAATGAAGTAGAAAAGTTTTATTCAGTACTTTGAGTGCTCAAAAAATACAATC

AGTGTATTATATGTGATTCATAGGTCAGTCATTTGAGGCCATTGACTCTAAGGCTTTTAATTAGAAACTAGTTGAAGACTCACCCTTGAATTAAGTCTGG

GGAAATGGCCTCCCGGAGGATGCAGTGACTGTAGAACAGAGATGAAATTCTACTCTAGTTGACAATTGAGCAGATGGATGATCCACAACAGTGCGTGGGG

AATGGGCAGATGATAGGCGTGCCGAGCGCCTATGATTGGCCAGCAGCTGCAGAATAAAGGATGGCGTCTTCTGTGGGCAGACTAGCTGTAGTGTGGGGAG

GGGGAGGGGAGGTGGGCATGAGCTGTTGAAAGGTTACCGGGCTATGATATAGAAAAGCTTTTATGAACTTGTTTCTCTTCAGTAAAGACTTATCTCGCTC

TCAGTAAAGAAGTTCCTAAGTTTGCAGCTGCTTAACCTCCCCCACAAGGTGGATGTGCCGTCTTCCTCCTCCCTCAGCATGGTGCGCCTTGTTATACCTC

AATGTCCAGCAGCCCCTGGTGCCTGACAGTGCTCTCTGACCTTATCAAACCCTCCATGCTGACTGTGGGAGATTTAAGCACCCTGACTCTCACTAAATTT

GAATCACGGCCTGAACGTAGTCTTTCTTGTTGTGTCCAGCAGTGTTTAATGCTTCCTGGCTGTAGTAGGTAGCATACAGGTAAGAACTTAACTGGTTATT

CTTGAATTTCTTTTACAATAAACCAATTTTTATAATCTTAAAA
Translation
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQ ASTDAGT

AGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLN - UNI581 - NHNDQTTTWQD

PRKAMLSQLNVPAPASPAVPQTLMNSASG - UNI68 - GPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFA - UNI5357 - AMNQRITQ

SAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQ - UNI35488 - AIRNINPSTANAPKCQ - UNI35488 - ELA

LRSQLPTLEQDGGTPNAVSSPGMSQELRTMTTNSSDPFLNS - UNI35488 - SGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTG GDTIS

QSTLPSQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL
Transcript ENSMUST00000086580
Sequence
TTGGGCGTCTGGAGCCAAAGTTTCTGTCTCAGTTGGGACGCCGCCGCGGCCGGGGGCAAAGAAAGGGAGGAAGGAAGGAGCTCGCGGAGGGGAGGGGAGG

AGAGGGGAGGCGGCCTCGGGCAAGGAGTGCAGGGCGATGCGGGCGCGCGTCGCAGCCCCCCGAACCTGAGCGCAGTGCCCCGAGCGTCGAACGAGGCCGC

AGCCATGGAGCCCGCGCAACAGCCGCCGCCCCAGCCGGCCCCGCAAGGCCCCGCGCCGCCGTCCGTGTCTCCGGCCGGGACCCCCGCGGCCCCGCCCGCA

CCCCCGGCCGGCCACCAGGTCGTGCACGTCCGCGGGGACTCGGAGACCGACTTGGAGGCGCTCTTCAATGCCGTCATGAACCCCAAGACGGCCAACGTGC

CTCAGACCGTGCCCATGCGGCTTCGCAAGCTGCCCGACTCCTTCTTCAAGCCGCCTGAGCCCAAGTCCCACTCGCGACAG GCCAGTACTGATGCAGGTA

CTGCGGGAGCTCTGACTCCACAGCATGTTCGAGCTCACTCCTCTCCAGCCTCCCTGCAGCTGGGTGCCGTTTCTCCTGGGACACTCACAGCCAGTGGCGT

TGTCTCTGGCCCTGCCGCTGCCCCTGCAGCTCAGCATCTCCGGCAGTCCTCCTTTGAGATCCCTGATGATGTACCACTGCCAGCAGGCTGGGAGATGGCC

AAGACATCTTCTGGTCAAAGATACTTCTTAAA - UNI581 - TCACAACGATCAGACAACAACATGGCAGGACCCCCGGAAGGCCATGCTTTCGCAAC

TGAACGTTCCTGCGCCTGCCAGCCCAGCGGTGCCCCAGACGCTGATGAATTCTGCCTCAG - UNI68 - GACCTCTTCCTGATGGATGGGAGCAAGCC

ATGACTCAGGATGGAGAAGTTTACTACATAAACCATAAGAACAAGACCACATCCTGGCTGGACCCAAGGCTGGACCCTCGTTTTG - UNI5357 - CC

ATGAACCAGAGGATCACTCAGAGTGCTCCAGTGAAGCAGCCCCCACCCTTGGCTCCCCAGAGCCCACAGGGAGGCGTCCTGGGTGGAGGCAGTTCCAACC

AGCAGCAGCAAATACAGCTGCAGCAGTTACAGATGGAGAAGGAGAGACTGCGGTTGAAACAACAGGAATTATTTCGGCAG - UNI35488 - GAATTA

GCTCTGCGCAGCCAGTTGCCTACACTGGAGCAGGATGGAGGGACTCCGAATGCAGTGTCTTCTCCTGGGATGTCTCAGGAATTGAGAACAATGACAACCA

ATAGTTCCGATCCCTTTCTTAACAG - UNI35488 - TGGCACCTATCACTCTCGAGATGAGAGCACAGACAGCGGCCTCAGCATGAGCAGCTACAGC

ATCCCTCGGACCCCAGACGACTTCCTCAACAGTGTGGATGAAATGGATACAG GAGACACCATCAGCCAAAGCACCCTGCCGTCACAGCAGAGCCGCTTC

CCCGACTACCTGGAAGCCCTCCCTGGGACAAATGTGGACCTTGGCACACTGGAAGGAGATGCAATGAACATAGAAGGGGAGGAGCTGATGCCCAGTCTGC

AGGAAGCGCTGAGTTCCGAAATCTTGGACGTGGAGTCTGTGTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTCACGTGGTTATAGAGCTGCAGGGA

GCCACTCTGAGTCTGTGAGGGATCCACAGAGCCTAAGATGTGCACGCCTGAAATTCAGATAAGTCAGTGGGGGTTCTCTGGCTAACACAGAAAACAGATG

AACCAGTGTCCATCGTTGTTCCGCTTTTCTCTGCCCGTCGCTGCTCTTACGTTGGTTGCTGACCTCTTCACGGCCGGCTCTAAAGAACCCGAACCGCAGA

CAGATTCCTTTGTTAACTCTGCTATGATAACTACGTTCTCTGGGATTGCTGGGGGATGGCCTGCTGGATAATGGATGTTCTGCCTTTTGTCCGGTGGTCC

TTTCACCATCACTTTAACTGAACACACAGACTGGGAACTGAATGCTCTAGAACATTGTTCAAGAGGTGGTTTCTTCAGCTGCCTTGGGTCCAACAAGCCA

GAGGCATTGCGTCTGATCTCGTGGAGGACGGAGGGGACCCACGCTGAAGACTGGTGAACTTTCCATTCTTCTGTTAGCGATGCCGTTAGGCCATAGTGAC

CTGGGTCTTATCTTAGACGCTTATGAGGCATGAGACAGCTTCCATAGAAATATATTAATTATTACCACATACTCTAGATTAGGTTTGAATGAATATTTTC

TGTGGGTGTTTTGGTTGGTTTTTCTCTGCCCCCCCCCCCTTTTTTGTGGTTGGTCTTGGTGGAACGTAGGCAAATTAATGAATTCGTTTATAGCTGTAGC

TTGGGGTGGGCAATACCATTCTTTTGGTGGGAAATCTGTATTTCTTGGTTTTTTAACATCCTATTTAAATCTTAAATCTTGGTTATCTCCTCTCTACATA

TATACACACTCTTATTATGTCTATGGTAGTGTGATAGCAGAATATATCTTTATAAACATTTCTTTCCTTTCCAGTTTATTTTTTAAATGGTAGCCTTGAA

CATATACATTTAGACACAGTAGTTTATGTTTCACAAATACTTTAAATTCTGGTTGGAGCAATTGCAGGTGTTTGAGGGAGGGTGGGCAGTGTTATAGAAA

GGGCTCTAGTGGGTAAAGCCAAGAGGCGCCTCTTGCCCTCTGTGCACTGTGGTGACAACAGAAGCCAACAGTGAGTGGCCTTACTTCCCTTAGCCTGATT

TCATGCCATGTAGTGTCTGAGCTGTAAGCTTTAGAGAGGCAGGCCTGCCTTCTGCCTCCACCTCAGCTTTGGGTGTACACTCAGATACTGAGACTGATAA

TCCACGAGGTCAGGTTGAGTGTCACCTACAAGATCATGCTTAGGAAACCTCCTCCCGTGTCTGCTGAGTGGACCCTGGGGTAGTGTGCAGAATGCTGCGA

GGTCATAGGTAAAGTGATCAGACTAGCAAGTGTGGGGTAGTTGGACTGAGCAGAGCTACAATGAAGCATGATTATGGCTTTATTTTTGCAAGATTACTAG

AGTATGTGTCTCCAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAATAGGCATGAATTAACTCTGTGTATAAGCTATGAAGTAATAGT

TGGTTATGAATTATAGTGGCACCAGCTAGCACCTCTGTCATTTAAGGGTCTTTGAGTGCTTCTAGAAGAATCCCTTATTTTCAAGGGTTCATAATGAACA

ACAATTTTCCCCCCTGGCTAAAGCTGCTACTATAAAATCCTCAGCTTAGGAAGATAGAAATCTTTTGGCCCTTTGATTTAGTATAGCACAAGAATGAAGT

AGAAAAGTTTTATTCAGTACTTTGAGTGCTCAAAAAATACAATCAGTGTATTATATGTGATTCATAGGTCAGTCATTTGAGGCCATTGACTCTAAGGCTT

TTAATTAGAAACTAGTTGAAGACTCACCCTTGAATTAAGTCTGGGGAAATGGCCTCCCGGAGGATGCAGTGACTGTAGAACAGAGATGAAATTCTACTCT

AGTTGACAATTGAGCAGATGGATGATCCACAACAGTGCGTGGGGAATGGGCAGATGATAGGCGTGCCGAGCGCCTATGATTGGCCAGCAGCTGCAGAATA

AAGGATGGCGTCTTCTGTGGGCAGACTAGCTGTAGTGTGGGGAGGGGGAGGGGAGGTGGGCATGAGCTGTTGAAAGGTTACCGGGCTATGATATAGAAAA

GCTTTTATGAACTTGTTTCTCTTCAGTAAAGACTTATCTCGCTCTCAGTAAAGAAGTTCCTAAGTTTGCAGCTGCTTAACCTCCCCCACAAGGTGGATGT

GCCGTCTTCCTCCTCCCTCAGCATGGTGCGCCTTGTTATACCTCAATGTCCAGCAGCCCCTGGTGCCTGACAGTGCTCTCTGACCTTATCAAACCCTCCA

TGCTGACTGTGGGAGATTTAAGCACCCTGACTCTCACTAAATTTGAATCACGGCCTGAACGTAGTCTTTCTTGTTGTGTCCAGCAGTGTTTAATGCTTCC

TGGCTGTAGTAGGTAGCATACAGGTAAGAACTTAACTGGTTATTCTTGAATTTCTTTTACAATAAACCAATTTTTATAATCTTAAAA
Translation
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQ ASTDAGT

AGALTPQHVRAHSSPASLQLGAVSPGTLTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLN - UNI581 - NHNDQTTTWQD

PRKAMLSQLNVPAPASPAVPQTLMNSASG - UNI68 - GPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRLDPRFA - UNI5357 - AMNQRITQ

SAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEKERLRLKQQELFRQ - UNI35488 - ELALRSQLPTLEQDGGTPNAVSSPGMSQELRTM

TTNSSDPFLNS - UNI35488 - SGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTG GDTISQSTLPSQQSRFPDYLEALPGTNVDLGTLEG

DAMNIEGEELMPSLQEALSSEILDVESVLAATKLDKESFLTWL

For any suggestions or comments, please send an email to unitrap@crg.es