Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053111 (Fank1)
Chromosomal location
Chr 7: 140968544 - 141073206 (+)
Description
fibronectin type 3 and ankyrin repeat domains 1 Gene [Source:MGI (curated);Acc:Fank1-001]
RefSeq_dna
NM_025850 
RefSeq_peptide
NP_080126.1 
UniGene
Mm.87448 Mm.401494 
MGI
MGI:1914180 
Uniprot/SWISSPROT
Q9DAM9 
Human Ortholog
ENSG00000203780 (FANK1)
Omim not available
UniTrap UNI34036
Vector Insertion
Chr 7: 140968654 - 141044848
Public Clones IST10185B3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19075
Vector Insertion
Chr 7: 141045027 - 141053785
Public Clones not available
Private Clones OST405401 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121560
Sequence
CCGGGAGCAGCTGACCATGGAGCCCCACA - UNI34036 - AAGTCGTGCCACTCTCAAAGCCGCATCCTCCTGTTGTGGGCAAGGTGACTCATCACA

GCATCGAATTGTACTGGGATCTGGAACAGAAAGAGAAACGGCAAGGACCACAGGAGCAGTGGCTTCGGTTCTCCATTGAGGAGGAGGACCCCAAGATGCA

CAGCTACGGTGTCATTTACAC - UNI19075 - AATGTACTTTCCTTACTGGAAGAAAAGAAAAAAAAGATGCCAAGGAAGTCCTCTGTCCACTGAGC

AGAGTGCTACTCATCTGAGAGACCGACTTGAGAGAACAGCAAACTGTGACCACCGGGCTGAACACGTGACGTGCAGCATCTCTGAGGACGAGGTGTTTAT

TTATTTAGTTGAAGATTCACAGTGACTTTTATGTAATGGGCAACTCTTCCCACATTGAAATACATCTTTTTACCTAAGCATGTTCATATGTGGTCTCATC

ACT
Translation
MEPHK - UNI34036 - KVVPLSKPHPPVVGKVTHHSIELYWDLEQKEKRQGPQEQWLRFSIEEEDPKMHSYGVIYT - UNI19075 - TMYFPYW

KKRKKRCQGSPLSTEQSATHLRDRLERTANCDHRAEHVTCSISEDEVFIYLVEDSQ
Transcript ENSMUST00000065359
Sequence
GGTTGTCAGGGCAACCCGAGCGACGCCAGACGAAGACAGGCGTTAGGAGGGCGGCGCCGCCAGGGCTGGGCCCGAGGGCCCCCGGGAGCAGCTGACCATG

GAGCCCCACA - UNI34036 - AAGTCGTGCCACTCTCAAAGCCGCATCCTCCTGTTGTGGGCAAGGTGACTCATCACAGCATCGAATTGTACTGGGA

TCTGGAACAGAAAGAGAAACGGCAAGGACCACAGGAGCAGTGGCTTCGGTTCTCCATTGAGGAGGAGGACCCCAAGATGCACAGCTACGGTGTCATTTAC

AC - UNI19075 - GGGTTATGCAACAAGGCATGTGGTTGAAGGCCTAGAACCAAGGACACTATACAAATTTCGACTGAAGGTCACCAGCCCCTCTGG

AGAATATGAGTACAGCCCAGTCGTCTCGGTGGCTACGACCC GGGAGCCCATAAGTAGCGAACACTTTCATCGTGCTGTCAGTGTGAACGATGAAGATCT

CCTGCTTCGAATTTTGGAAGGAGG CCATGTCATGATTGACGTGCCCAACAAATTTGGCTTTACCGCTCTCATGGTTGCTGCTCAGAAAGGTTACACCAG

 GCTTGTGAAGATCCTAGTTTCCAATGGCACAGATGTGAATCTGAAGAACGGAAGTGGCAAGGACAG TCTCATGCTTGCATGCTACGCGGGGCACCTAG

ATGTTGTCAAATACCTCCGGAGACACGGAGCTTCTTGGGAGGCTCGAGACCTCGGAGGCTGCACAGCTCTGCACTGGGCTGCAGATGGAGGCCATTGCTC

TGTGATTGACTGGATGATAAAGGACGGTTGTGAG GTAGATGTTGTAGACACTGGTTCAGGATGGACGCCACTCATGAGAGTCTCCGCTGTGACAGGAAG

CCAGAAGGTGGCCTCACTCCTCATCGAGGCTGGGGCTGACGTGAACATCAAGGACAAAGATGGAAAGACGCCTCTCATG GTCGCTGTCTTAAATAATCA

CGAACAGCTAGTTCAGCTACTTCTTGATAAAGGGGCAGATGCAACTGTGAAAAATGAG TTTGGCAAAGGTGTCCTAGAAATGGCCAGAGTTTTTGACAG

ACAG AATGTACTTTCCTTACTGGAAGAAAAGAAAAAAAAGATGCCAAGGAAGTCCTCTGTCCACTGAGCAGAGTGCTACTCATCTGAGAGACCGACTTG

AGAGAACAGCAAACTGTGACCACCGGGCTGAACACGTGACGTGCAGCATCTCTGAGGACGAGGTGTTTATTTATTTAGTTGAAGATTCACAGTGACTTTT

ATGTAATGGGCAACTCTTCCCACATTGAAATACATCTTTTTACCTAAGCATGTTCATATGTGGTCTCATCACTGGGCCTCCGTAGAACAGGAATGTTTTC

TTGCCCTGTGCCTTTTGCAGTTAGACACAAAACCAAATACTTACGCATTGGTGTTACATAAACGAGAGTGCATGGGTCCCCACCCCTGTCTCCCCTTCCC

CTTAGCTGTCCTCGAGATGCTCCAGGCCTCCTGGCACCTTCCACTCATGTGTTTCTTATTATCTCTCCCACCCCACTGCAGGCCAGGCTGCTGTTGCCTC

CTGCGGCGGGCGGGGCTCCTCCTAAGCACCCAGGAGTTCCCTCTTAGGCTCTTGGCCTCACATCAAAGCCTAGAATACATATGTGTAGGCTGGCGTGGTT

CTGTTTGCAGTGTTTAGTTGAAGGACAGGGCTGCGAGGGCAGGTCCATCGGTTCATGTGTCTGCCCATGCTCACCTCTGTGGTGAAAGGACCCAGGCCCT

GGACAGCCTCCCCAGTGATTAGTGTGTTACATTGAGAGTAGATACGATTTTTGAGGCAAATCTTATAGGTTGTAGACAAAAAGGGGTTAAGACACCAAGA

CTGTCAGTTAAGAGCCCAAAGATAGAAATGTGGGAAGTTTTAGCTGGACCAAGCTTAAACATCAGCAGAAACATGTGCATCTTGTGTTTCCAGGGACAAA

CTGGTTCATTTAGCCTTCTAATAAAGCAGCT
Translation
MEPHK - UNI34036 - KVVPLSKPHPPVVGKVTHHSIELYWDLEQKEKRQGPQEQWLRFSIEEEDPKMHSYGVIYT - UNI19075 - TGYATRH

VVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTR REPISSEHFHRAVSVNDEDLLLRILEGG GHVMIDVPNKFGFTALMVAAQKGYTR RLVKILV

SNGTDVNLKNGSGKDS SLMLACYAGHLDVVKYLRRHGASWEARDLGGCTALHWAADGGHCSVIDWMIKDGCE VDVVDTGSGWTPLMRVSAVTGSQKVA

SLLIEAGADVNIKDKDGKTPLM VAVLNNHEQLVQLLLDKGADATVKNE FGKGVLEMARVFDRQ NVLSLLEEKKKKMPRKSSVH

For any suggestions or comments, please send an email to unitrap@crg.es