Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053128 (Rnf26)
Chromosomal location
Chr 9: 43903714 - 43921600 (-)
Description
ring finger protein 26 Gene [Source:MGI Symbol;Acc:MGI:2388131]
RefSeq_dna
NM_153762 
RefSeq_peptide
NP_717095.2 
UniGene
Mm.467202 Mm.392032 
MGI
MGI:2388131 
Uniprot/SPTREMBL
Q5PR90 Q8BUH7 Q8BZY8 Q99KC1 Q2TA95 
Human Ortholog
ENSG00000173456 (RNF26)
Omim not available
UniTrap UNI4767
Vector Insertion
Chr 9: 43921033 - 43921215
Public Clones AW0664 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5116
Vector Insertion
Chr 9: 43918867 - 43920167
Public Clones YTC263 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24924
Vector Insertion
Chr 9: 43906678 - 43920043
Public Clones not available
Private Clones OST200953 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093858
Sequence
ATGGAGGCTGTCTACCTGGTGGTGAATGGGGTGGGCCTGGTGCTGGACTTGCTGACCTTGATGTTGGATCTCAACTTCCTGCTCGTGTCCTCCCTCCTGG

CTACCCTGGCCTGGCTTTTGGCCTTCATCTACAATCTGCCACACACGGTACTTACCAGTCTTCTGCACTTGGGTCGAGGATTCCTGCTTTCTTTGCTGGC

CTTAGTTGAAGCTGTGGTCCGATTTACCTTCGGGGGACTGCAGGCCTTGGGGACGCTCCTCTATAGCTGCTACTCTGGCTTGGAGAGCTTAAAGCTACTG

GGGCACTTGGCCTCCCACGGAGCTCTGAGGAGCCGGGAATTCCTGAATCGGGGCATCCTGAACATGGTCTCCAATGGCCATGCTTTGCTGCGCCAGGCCT

GTGACATATGTGCTATTGCCATG - UNI5116 - AGTCTGGAGCCGCAGCCTACAACTGGCCAGCTGGCCAAATCGGGGAGGAGCACCAGGAGCCCCC

CAAGGTGGCCCCAGGAGGGTGTTCTCAGCCAGGATCCAGCCACAGGACACTCCTCCTGA
Translation
MEAVYLVVNGVGLVLDLLTLMLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLSLLALVEAVVRFTFGGLQALGTLLYSCYSGLESLKLL

GHLASHGALRSREFLNRGILNMVSNGHALLRQACDICAIAM - UNI5116 - SLEPQPTTGQLAKSGRSTRSPPRWPQEGVLSQDPATGHSS
Transcript ENSMUST00000065379
Sequence
GCTTGCCACGTCCCTTCGCAAACAAGATGGCGGCGCCCAGTGGAGTCGAGGCCGCGCTCGGGATTTGCCGAGGCTGACTTTCCGTCCCGCTCTCCCTTTG

GGTGCCACTCGCCGCGAGCGGGAGGACAGGGGCCGGGCGGGGACAGGGGCACTTGCGTGGCTGGACCGCGAGCCCGCGCCCAGCCTGCGCCGCCCCCACC

CGGCCCCGACCCGGCCCTTCCCGACTCCGTCCCATCCTTGCGGGTCTCCTCCCGGTCTGACCCGTGGCCCTGTCGTGTTTACCGCTCCAGGCTCCTAACG

CTGAGGTGCTTCCTCCGGTCCAGGCTCGCTGTCACTTTAGAGATGTTTCACCTCTTCGCTCCCGAACATTCCGCCTTCCAAGCCGGGACGCCGTTCCCTT

CTGTAAAAGTCTTCCCTGAAGCCCACTTCTGTAGCCCTTGCTTCTTCCTTGGTTAGACGTTCGCATCCCTTCCAAATTCACTCCGATCTCGCCACAATAG

TGGCAACCTTGACACCGCCTTCCCTGAGGAGCCAGCCTTCCTTTTGTCCTGAACTTCGCAGCCCTATCATGGAGGCTGTCTACCTGGTGGTGAATGGGGT

GGGCCTGGTGCTGGACTTGCTGACCTTGATGTTGGATCTCAACTTCCTGCTCGTGTCCTCCCTCCTGGCTACCCTGGCCTGGCTTTTGGCCTTCATCTAC

AATCTGCCACACACGGTACTTACCAGTCTTCTGCACTTGGGTCGAGGATTCCTGCTTTCTTTGCTGGCCTTAGTTGAAGCTGTGGTCCGATTTACCTTCG

GGGGACTGCAGGCCTTGGGGACGCTCCTCTATAGCTGCTACTCTGGCTTGGAGAGCTTAAAGCTACTGGGGCACTTGGCCTCCCACGGAGCTCTGAGGAG

CCGGGAATTCCTGAATCGGGGCATCCTGAACATGGTCTCCAATGGCCATGCTTTGCTGCGCCAGGCCTGTGACATATGTGCTATTGCCATGAGCCTGGTG

GCCTATGTGATCAACAGTCTAGTCAACATCTGCCTCATCAGCACTCAGAACTTCTTCTCCCTGGTGCTGGCCCTGTGGGATGCTGTAACGGGGCCTCTTT

GGAGGATGACAGACGTGGTGGCTGCTTTCCTCGCTCACATCTCCAGCAGTGCAGTGGCTATGGCCATTCTCCTGTGGACCCCCTGCCAGCTAGCACTGGA

GCTGTTGGCCTCAGCCGCCCGCCTGCTGGCCAGCTGTGTGGTTTTCCATCTCACTGGATTGGTGTTGCTGGCTTGCGTGCTGGCAGTGATTTTGATTGTG

TTGCACCCAGAACAAACCCTGAGGCTGGCCACTCAAGCTCTCAGTCAGCTTCATGCCCGCCCATCTTACCACCGGCTTTGGGAGGATATCGTACGGCTGA

CTCGCCTTCCACTAGGTCTGGAGGCTTGGCGCAGAGTCTGGAGCCGCAGCCTACAACTGGCCAGCTGGCCAAATCGGGGAGGAGCACCAGGAGCCCCCCA

AGGTGGCCCCAGGAGGGTGTTCTCAGCCAGGATCCAGCCACAGGACACTCCTCCTGAAGCAGAAGAGGAGGTCATCAGAACTGCACCAGCTAGAGGCCGA

GAGCAACTCAACGAGGACGAGCCTGCCGCTGGGCAGGACCCATGGAAGCTGTTGAAGGAGCAAGAAGAGCGGAAGAAGTGTGTTATCTGCCAGGACCAGA

GCAAAACGGTGCTGCTTCTGCCCTGCCGGCACCTGTGCCTGTGCCAGGCTTGCACTGAGATCCTCATGCGCCACCCTGTTTACCATCGCAACTGCCCGCT

CTGCCGCCGCAGCATCCTGCAAACCCTCAATGTCTACCTCTGAGGACTCCCTCCCTGCCTGCTCATCCTCTGCGCTCCACACACCGGGACAGCATCAACA

CTTTGCCTCTGGGTTCTGGCCTGAGTCTTCTTTGCCCCCGAAGGCGGCGACTCTGCCAAGCCTCAAGCCATATATCCAGGACGTGTAGCTTGGAATACTC

TGGAAGACTCCAGTCTGGGTGGGACAGAGTAACACTTTCTCTAAATCCTGTGTGGGGCCCTGAGATGCTGAGGGTG - UNI5116 - - UNI24924 

- ATGGGTCAGATGACCTGGCCACAGTCTGGGGCCTCCAAAAAAACATCCATGTGCCTGTCTGGAGCCTAGGTGGAGGACAGATTCGACAGCAGAGGCAT

GAAGACCACTAGAAAATCGTCTCTAAGGTCCTGAGGCAAGCCATGTCGTCTACCAAGGAGGGAGCTATCCCAGCAGCCATTGCTTCCTCTTTCTTG GTT

AGAAAGCTGTCTTCCTTCGTGAGGTTGGCCAACCAGGAGCACACACAGGCCCCAAGTGACACAGGTATTTGTGCCACAACAGAAGATGGTTAGAGAAGAC

TTTGCTGTTCCAATGCCTACAGTGCTACAGCCAGCTAGGCAGAGAAACCACCAGCTGTGTCCGTTTCCCCACTGATGGCCCGGGTACCACCAGCTGTGTC

CGTTTCCCCACTGATGGCCCGGGTACCACCAGATGTGTCCGTTTCCCCAGGTGTTCACACTGTGCCCTTGGCAGGTTCTGTCTGGAAGATGCTGCTGGGG

TCTTTGGAAGTGTGATGTGCCTCATCTCTAAACATCTTGGCTAAAAGAATAAAACACGTGGACAAACGCAACCTGCGAATCCAGATGTGGCATATGGCAT

CTGAAATATGTACTATTTAAGGAACAAAAAATAATTGAGAAGTTTAACAAGTGGGTAAGCTAGGATGCAGCACTTATGGCAAAAGCAGTGAACTGTGTGG

TCCTCACTTTGCTGGGAGCATCCCGGATACAAGCCCCTCCCAAATCAAGACCGTCACACC
Translation
MEAVYLVVNGVGLVLDLLTLMLDLNFLLVSSLLATLAWLLAFIYNLPHTVLTSLLHLGRGFLLSLLALVEAVVRFTFGGLQALGTLLYSCYSGLESLKLL

GHLASHGALRSREFLNRGILNMVSNGHALLRQACDICAIAMSLVAYVINSLVNICLISTQNFFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAI

LLWTPCQLALELLASAARLLASCVVFHLTGLVLLACVLAVILIVLHPEQTLRLATQALSQLHARPSYHRLWEDIVRLTRLPLGLEAWRRVWSRSLQLASW

PNRGGAPGAPQGGPRRVFSARIQPQDTPPEAEEEVIRTAPARGREQLNEDEPAAGQDPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILM

RHPVYHRNCPLCRRSILQTLNVYL - UNI5116 - - UNI24924 -  
Transcript ENSMUST00000056328
Sequence
GTCGAGGCCGCGCTCGGGATTTGCCGAGGCTGACTTTCCGTCCCGCTCTCCCTTTGGGTGCCACTCGCCGCGAGCGGGAGGACAGGGGCCGGGCGGGGAC

AGGGGCACTTGCGTGGCTGGACCGCGAGCCCGCGCCCAGCCTGCGCCGCCCCCACCCGGCCCCGACCCGGCCCTTCCCGACTCCGTCCCATCCTTGCGGG

TCTCCTCCCGGTCTGACCCGTGGCCCTGTCGTGTTTACCGCTCCAGGCTCCTAACGCTGAGGTGCTTCCTCCGGTCCAGGCTCGCTGTCACTTTAGAGAT

GTTTCACCTCTTCGCTCCCGAACATTCCGCCTTCCAAGCCG - UNI4767 - GGACGCTCCTCTATAGCTGCTACTCTGGCTTGGAGAGCTTAAAGCT

ACTGGGGCACTTGGCCTCCCACGGAGCTCTGAGGAGCCGGGAATTCCTGAATCGGGGCATCCTGAACATGGTCTCCAATGGCCATGCTTTGCTGCGCCAG

GCCTGTGACATATGTGCTATTGCCATGAGCCTGGTGGCCTATGTGATCAACAGTCTAGTCAACATCTGCCTCATCAGCACTCAGAACTTCTTCTCCCTGG

TGCTGGCCCTGTGGGATGCTGTAACGGGGCCTCTTTGGAGGATGACAGACGTGGTGGCTGCTTTCCTCGCTCACATCTCCAGCAGTGCAGTGGCTATGGC

CATTCTCCTGTGGACCCCCTGCCAGCTAGCACTGGAGCTGTTGGCCTCAGCCGCCCGCCTGCTGGCCAGCTGTGTGGTTTTCCATCTCACTGGATTGGTG

TTGCTGGCTTGCGTGCTGGCAGTGATTTTGATTGTGTTGCACCCAGAACAAACCCTGAGGCTGGCCACTCAAGCTCTCAGTCAGCTTCATGCCCGCCCAT

CTTACCACCGGCTTTGGGAGGATATCGTACGGCTGACTCGCCTTCCACTAGGTCTGGAGGCTTGGCGCAGAGTCTGGAGCCGCAGCCTACAACTGGCCAG

CTGGCCAAATCGGGGAGGAGCACCAGGAGCCCCCCAAGGTGGCCCCAGGAGGGTGTTCTCAGCCAGGATCCAGCCACAGGACACTCCTCCTGAAGCAGAA

GAGGAGGTCATCAGAACTGCACCAGCTAGAGGCCGAGAGCAACTCAACGAGGACGAGCCTGCCGCTGGGCAGGACCCATGGAAGCTGTTGAAGGAGCAAG

AAGAGCGGAAGAAGTGTGTTATCTGCCAGGACCAGAGCAAAACGGTGCTGCTTCTGCCCTGCCGGCACCTGTGCCTGTGCCAGGCTTGCACTGAGATCCT

CATGCGCCACCCTGTTTACCATCGCAACTGCCCGCTCTGCCGCCGCAGCATCCTGCAAACCCTCAATGTCTACCTCTGAGGACTCCCTCCCTGCCTGCTC

ATCCTCTGCGCTCCACACACCGGGACAGCATCAACACTTTGCCTCTGGGTTCTGGCCTGAGTCTTCTTTGCCCCCGAAGGCGGCGACTCTGCCAAGCCTC

AAGCCATATATCCAGGACGTGTAGCTTGGAATACTCTGGAAGACTCCAGTCTGGGTGGGACAGAGTAACACTTTCTCTAAATCCTGTGTGGGGCCCTGAG

ATGCTGAGGGTGGTGAGTATGTCACTATGCAAGGGCCCTGAGACTCTGTGGTGGGCTCTTGTGCTGCGCCTGCCAGGGCCCACCCAGATGCCTGCCTCTA

GGGCTGTCCTTCTCTGCTTCTGGCTCTTTTGTTGGAGTTTTTGGTCCTTTCCCCCAGGCCACGCCACGCCACGCCACATCAGTGTTGTTTGAGGATTTTG

GAAACTCATGGGCCTTAGAGTGATCTTGATTCTTTTTCTCTTTTTTGTTTTTTCTTGGTTTGGATCTTGAACCTTTATGTTCAGCCAGAGCCTCTGCCCT

GGTAGGTCTGGGAGTAGAAACTTGCAGATGCCCTTCTGCCTGTCACTGTCTTTTAAAGACTCCCAACTTGACCAGGACCTGGAGTCAGGAGTTTATCCCT

GAGTACAGGGGTGCAGCTACACCTGGCTTTGGGACCATTCACCTTCAGGCACCCCAGCTCCATGGGGAGCCTCGGAAGGAACAACCAGATGTCTACTCAT

TCCCTACATGGCATAGAACATAGCATTCCTCCTGGGCTCTCTCCGGCAGTGGAGAGGGCATCCCGCACTTTTCACTTGGGTCCAAACGAGGGGCTGGGCC

TCAGGGGTCATAGCTCCATTTAGTCGGTCGGACTGCCCAGTTTCTATGAATAAAGTTCTCTTGACAGCT
Translation
SRPRSGFAEADFPSRSPFGCHSPRAGGQGPGGDRGTCVAGPRARAQPAPPPPGPDPALPDSVPSLRVSSRSDPWPCRVYRSRLLTLRCFLRSRLAVTLEM

FHLFAPEHSAFQAG - UNI4767 - GTLLYSCYSGLESLKLLGHLASHGALRSREFLNRGILNMVSNGHALLRQACDICAIAMSLVAYVINSLVNICL

ISTQNFFSLVLALWDAVTGPLWRMTDVVAAFLAHISSSAVAMAILLWTPCQLALELLASAARLLASCVVFHLTGLVLLACVLAVILIVLHPEQTLRLATQ

ALSQLHARPSYHRLWEDIVRLTRLPLGLEAWRRVWSRSLQLASWPNRGGAPGAPQGGPRRVFSARIQPQDTPPEAEEEVIRTAPARGREQLNEDEPAAGQ

DPWKLLKEQEERKKCVICQDQSKTVLLLPCRHLCLCQACTEILMRHPVYHRNCPLCRRSILQTLNVYL

For any suggestions or comments, please send an email to unitrap@crg.es