Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053134 (Supt7l)
Chromosomal location
Chr 5: 31816943 - 31829109 (-)
Description
suppressor of Ty 7 (S. cerevisiae)-like Gene [Source:MGI (curated);Acc:Supt7l-002]
RefSeq_dna
NM_028150 
RefSeq_peptide
NP_082426.1 
UniGene
Mm.398470 Mm.164187 
MGI
MGI:1919445 
Uniprot/SWISSPROT
Q9CZV5 
Uniprot/SPTREMBL
Q8BXI0 Q3UMC6 
Human Ortholog
ENSG00000119760 (SUPT7L)
Omim not available
UniTrap UNI33054
Vector Insertion
Chr 5: 31827557 - 31829080
Public Clones (sanger) IST14620C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23403
Vector Insertion
Chr 5: 31825635 - 31827557
Public Clones not available
Private Clones OST260918 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6606
Vector Insertion
Chr 5: 31820639 - 31820878
Public Clones YHB379 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118874
Sequence
AGTGCTTCCGTGGCCTTGGTCCATTAATCAATAAACAAGGCTCCTAGGCTTGACCTAGTCCTCGACTCCGACCTGTCAGAGTCAGGCAGCCGCGTATACC

ACTCCTGGGGCAGGGCG - UNI23403 - - UNI33054 - GGAGAGTATTGTCTGTCCTAGAGTTTTGCTAGCACCTTTTTAAAGTGATCTTAGCT

TGCTTCTTATGTGGGAACTGCCTAGACTTCCTACTTTTCACTGCAGAAGCTTCTGATCTACAGTTGCCAGAGACGGAAGCACACACCTTTAGGAGATCGT

TTACATTAAGCTGGAGAGCCCTTCTCTGCTTGCTCTAAAATGCTGAGGTACTGGGGAGAGATACCAATACCGTCAGGACAGACCAACAGAAGTTCCTTTG

ATCTGCTCCCACGGGAGTTCCGTCTGGTGGAAGTCCATGACCCGCCCCTGCACCAGCCCTCAGCCAACAAGCCGAAGCCCCCCACGATGCTGGACATTCC

CTCAGAACCGTGTAGCCTCACCATCCATACCATTCAGTTGATCCAACACAACCGACGCCTGCGCAGCCTTATTGCCACAGCTCAGACCCAGAGTCAGCAG

CAGACAGAGGGTGTGAAGGCTGAAGAGAGTGAACCTCTTCCCTCCTGCCCTGGCTCACCTCCTCTCCCTGATGACCTCCAGCCTTTAGACTGTAAAAATC

CCAATGCTCCATTCCAGATCCGGCACAGTGACCCAGAGAGTGACTTTTACCG CGGGAAAGGAGAGCCTGTGACAGAGCTGAGCTGGCACTCCTGCCGGC

AGCTCCTCTATCAAGCAGTCGCCACAATCCTGGCCCACACAGGCTTTGAGTGTGCTAATGAAAGTGTCCTGGAGACCCTAACTGATGTGGCACATGAATA

CTGCCTCAAGTTCACCAAGCTGCTGCGCTTTGCTGTCGACCGAGAGGCCCTGCTGGGACAGACTCCTTTCCCTGATGTAATGGAACAGGTGTTCCATGAA

GTGGGCATTGGCAGTGTGCTCTCCCTGCAGAAGTTCTGGCAGCACCGCATCAAGGACTATCACACTTACATGCTACAG - UNI6606 - ATTAGTAAG

CAGCTCTCTGAAGAATATGAAAGGATTGTGAATCCCGAGAAGGCCACAGAAGACACTAAACCTGTGAAGATCAAGGAAGAGCCTGTGAGCGACATCACAT

TTCCTGTCAGTGAGGAGCTAGAAGCGGACCTTGCTTCTGGAGATCAGTCCTTACCCATTGGGGTCCTCGGGGCTCAGAGTGAGCGCTTCCCATCCAACCT

GGAGGTGGAGGCTTCGCCACAGGCTCCAAGTAAGAAAGAAAGTTGTATTCATTTTGCATCTGGCTCTGCCCATCTTAGCACTTCCTGACACTTTGGAATC

AACTCCAAGTGGGAGAAAGGCAGACATGGGCAGAACAGAAGTTGCTGGAGCAAACAGAGCTGTGGTGAATCCTTTACAGTACTCTCTGGTTTAAGGAGCT

GTTTCCTTGATAGGAACTTCAAGAAAATTGCAGACCAAAGGGAATGAAATTGTTGTGTGTTGGATGGAGTTGTTCTGTTGTAGGTTATAGCCATGAGGAC

TTTAGGAGCCTGCAGAACTGGCTTGTTACTTTTTATTTTTTTATTTTTTATTTTTTTAAGATTTATTTATTTATTATATGTAAGTACACTGTAGCTGTCT

TCAGACACCCCAGAAGAGGGCGTCAGATCTCATTACGGGTGGTTGTGAGCCACCATGTGGTTGCTGGGATTTGAACTCTGGACCTTCAGAAGAGCAGTCA

GTGCTCTTACCAGTTGAGCCATCTCACCAGCCCTACTTTTTATTTTTAAGCAATTATATTTTGGTTTAGTTCTTGAGACAGGGTCTTGCTGTAGGGTTGT

GGGTCCCTCATCTGCTCCACCACAGGGGAGGTGGGATGTGGGGAGTTTTGACTGTGCTTATGGGGGTTGAGGGGAGCAGTCCCAACCCTGGGCCTGCAAC

AATGCTTGGGCTGTGGGGTTCTCACAGGCTCTTGGATATCCAGGCACTGTTGGGAGTCACAGAAAAGTGTGGGCCTTTGGGCTGGGTTTAACCTAAGGTG

GGTGGGGGGAGGAGAGCTCCAGCTGGTCCCACCGAAAGAGTCCTTGGCTTGATGGGGCAGCAGGCTTGCTGGCGGTTGTGGCTGGGAGTTCAGAGAGGCC

GTCTACAGATTAGGCTGTGCTCTATAGGCAAAGGCCTTTCCCATGGCTCCCCACAACAGATCAATGAAAAGAGGCAGTCCATGGTTCTAAGGCATTTATT

GTATGGCGGGAAGTGGGTGTATAAAACCATCCCCACTTCTCTGGTGGGCCTGAGGTAAACACCTTTTACAGGGAGGAGCGTCTGGGAAGGAAAGCTTATT

GGCTATGCTCCGGGCCTCTAGGTACCTCATTAGCAGAGAGACCTCTTGGCCGTGTCTCTTTTATGTGAGAAACGTGGCATGTGTGTTCCGAGTCAGGAGT

CTGGCAGGGAGCTGGGAGTCACCTAAGCCTCAGGTGTGTGACCACCAAGTCCCCAGGTCTCGCCCTGCTCTACCTTAGCAAACATCCTAAACATCCTGAC

ATGATTTTACACCCCACACCTTGCCATCTTGCCATCTAGGTAGGTCTGGAATTGAAGGCCTCCTGCTTTAGCCTCCCACGAGCTCCCACGGGCTGCAGTT

GCTGTGCTTCACTCGCTATCCCGACTCAGCTCAGTTGCAAATTAGTTTGAACACTTAGTTGTTTACAAATGTAAACACGTAAGAAATTTAAATATCACAT

CCTCATATGTGACCCAAACAAAATTAGGTCAGCCTTAGAAGCGCTGAGAGGTTTTTCTCTGAGGAAGACATAATAGTTAACAGCAGAGCTGCATTACCAA

AATACAGAAAGACAGAGGACACCAACAACCATGTCTCCTGTCAGGAGAGACAAGTAGAGAGCTGATGTCAGCATCACGTGTGAACATAGTCTTCAAAATG

CAAAAGAGGCCTAGAGAGATTCTCAAATAAAAGGGAAAAAGCCAAATGAAAAGAAGGCCAGAGGACAGCCAGGGCTATACAGAGAAACCCTGTTTCG
Translation
 - UNI23403 - - UNI33054 - MLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRR

LRSLIATAQTQSQQQTEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYR RGKGEPVTELSWHSCRQLLYQAVATILAHTGFEC

ANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHTYMLQ - UNI6606 - ISKQLSEEYERI

VNPEKATEDTKPVKIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPSKKESCIHFASGSAHLSTS
Transcript ENSMUST00000120574
Sequence
GACAAAGATCTTACACCGTCACACAATGTATTCATTTGATGTTTGTTGGACCTGAGGAGACATATAGGCAGTAAACCTGGAGAC - UNI23403 - - 

UNI33054 - GTACTGGGGAGAGATACCAATACCGTCAGGACAGACCAACAGAAGTTCCTTTGATCTGCTCCCACGGGAGTTCCGTCTGGTGGAAGTCC

ATGACCCGCCCCTGCACCAGCCCTCAGCCAACAAGCCGAAGCCCCCCACGATGCTGGACATTCCCTCAGAACCGTGTAGCCTCACCATCCATACCATTCA

GTTGATCCAACACAACCGACGCCTGCGCAGCCTTATTGCCACAGCTCAGACCCAGAGTCAGCAGCAGACAGAGGGTGTGAAGGCTGAAGAGAGTGAACCT

CTTCCCTCCTGCCCTGGCTCACCTCCTCTCCCTGATGACCTCCAGCCTTTAGACTGTAAAAATCCCAATGCTCCATTCCAGATCCGGCACAGTGACCCAG

AGAGTGACTTTTACCG CGGGAAAGGAGAGCCTGTGACAGAGCTGAGCTGGCACTCCTGCCGGCAGCTCCTCTATCAAGCAGTCGCCACAATCCTGGCCC

ACACAGGCTTTGAGTGTGCTAATGAAAGTGTCCTGGAGACCCTAACTGATGTGGCACATGAATACTGCCTCAAGTTCACCAAGCTGCTGCGCTTTGCTGT

CGACCGAGAGGCCCTGCTGGGACAGACTCCTTTCCCTGATGTAATGGAACAGGTGTTCCATGAAGTGGGCATTGGCAGTGTGCTCTCCCTGCAGAAGTTC

TGGCAGCACCGCATCAAGGACTATCACACTTACATGCTACAG - UNI6606 - ATTAGTAAGCAGCTCTCTGAAGAATATGAAAGGATTGTGAATCCC

GAGAAGGCCACAGAAGACACTAAACCTGTGAAGATCAAGGAAGAGCCTGTGAGCGACATCACATTTCCTGTCAGTGAGGAGCTAGAAGCGGACCTTGCTT

CTGGAGATCAGTCCTTACCCATTGGGGTCCTCGGGGCTCAGAGTGAGCGCTTCCCATCCAACCTGGAGGTGGAGGCTTCGCCACAGGCTCCAA - UNI6

606 - GTGCAGAGGTCAATGCTTCTCCTCTCTGGAACCTGGCTCACGTGAAAATGGAACCTCAAGAAAGTGAAGAAGGCAATGTGTCTGCGCATGGGGT

GCTGGGCAGTGATGTCTTTGAGGAGCCAATGTCAGGCATGAGTGAGGCTGGACTCCCTCAGAGCCCTGACGACTCAGACAGCAGCTATGGTTCCCACTCC

ACTGACAGCCTCATGGGGTCCTCCCCTGTGTTCAATCAGCGCTGCAGGAAGAGGATGAGGAAGATTTAACTGCAGAGCGCCAGCAGGAAGCCCATGAGTA

GTAATTAGACTGTATTCTTAAGTGTAGACCTTTGCTAATGTCAGAGACAGTTCCTAACCTAGTAACAGTTCACTTTGCGTCGTTTCTGTACTTCTTTAAA

ACAACTAAGCCACCGTTCGCAGCTGAGTTGTGATACTGACCTGGTAATCAGACCAAAGTACTGTCCCGGCTGGTTTTATCTCAGCTCCTCTCAGCCGTGT

CTCTGGCACGCTTGAGAGGAGTCATGCCACTTTGATGCTCCTTGCAGAGGTGGGACACTGAGGTGCTTTGCTTAAATTTCAAAGCTTGCATATATTCATG

TAAATATATGC
Translation
 - UNI23403 - - UNI33054 - MLDIPSEPCSLTIHTIQLIQHNRRLRSLIATAQTQSQQQTEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPN

APFQIRHSDPESDFYR RGKGEPVTELSWHSCRQLLYQAVATILAHTGFECANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHE

VGIGSVLSLQKFWQHRIKDYHTYMLQ - UNI6606 - ISKQLSEEYERIVNPEKATEDTKPVKIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGA

QSERFPSNLEVEASPQAPS - UNI6606 - SAEVNASPLWNLAHVKMEPQESEEGNVSAHGVLGSDVFEEPMSGMSEAGLPQSPDDSDSSYGSHSTDS

LMGSSPVFNQRCRKRMRKI
Transcript ENSMUST00000117642
Sequence
GAAGAAGTGCTTCCGTGGCCTTGGTCCATTAATCAATAAACAAGGCTCCTAGGCTTGACCTAGTCCTCGACTCCGACCTGTCAGAGTCAGGCAGCCGCGT

ATACCACTCCTGGGGCAGGGCG - UNI23403 - - UNI33054 - AAGCTTCTGATCTACAGTTGCCAGAGACGGAAGCACACACCTTTAGGAGAT

CGTTTACATTAAGCTGGAGAGCCCTTCTCTGCTTGCTCTAAAATGCTGAGGTACTGGGGAGAGATACCAATACCGTCAGGACAGACCAACAGAAGTTCCT

TTGATCTGCTCCCACGGGAGTTCCGTCTGGTGGAAGTCCATGACCCGCCCCTGCACCAGCCCTCAGCCAACAAGCCGAAGCCCCCCACGATGCTGGACAT

TCCCTCAGAACCGTGTAGCCTCACCATCCATACCATTCAGTTGATCCAACACAACCGACGCCTGCGCAGCCTTATTGCCACAGCTCAGACCCAGAGTCAG

CAGCAGACAGAGGGTGTGAAGGCTGAAGAGAGTGAACCTCTTCCCTCCTGCCCTGGCTCACCTCCTCTCCCTGATGACCTCCAGCCTTTAGACTGTAAAA

ATCCCAATGCTCCATTCCAGATCCGGCACAGTGACCCAGAGAGTGACTTTTACCG CGGGAAAGGAGAGCCTGTGACAGAGCTGAGCTGGCACTCCTGCC

GGCAGCTCCTCTATCAAGCAGTCGCCACAATCCTGGCCCACACAGGCTTTGAGTGTGCTAATGAAAGTGTCCTGGAGACCCTAACTGATGTGGCACATGA

ATACTGCCTCAAGTTCACCAAGCTGCTGCGCTTTGCTGTCGACCGAGAGGCCCTGCTGGGACAGACTCCTTTCCCTGATGTAATGGAACAGGTGTTCCAT

GAAGTGGGCATTGGCAGTGTGCTCTCCCTGCAGAAGTTCTGGCAGCACCGCATCAAGGACTATCACACTTACATGCTACAG - UNI6606 - ATTAGT

AAGCAGCTCTCTGAAGAATATGAAAGGATTGTGAATCCCGAGAAGGCCACAGAAGACACTAAACCTGTGAAGATCAAGGAAGAGCCTGTGAGCGACATCA

CATTTCCTGTCAGTGAGGAGCTAGAAGCGGACCTTGCTTCTGGAGATCAGTCCTTACCCATTGGGGTCCTCGGGGCTCAGAGTGAGCGCTTCCCATCCAA

CCTGGAGGTGGAGGCTTCGCCACAGGCTCCAA - UNI6606 - GTGCAGAGGTCAATGCTTCTCCTCTCTGGAACCTGGCTCACGTGAAAATGGAACC

TCAAGAAAGTGAAGAAGGCAATGTGTCTGCGCATGGGGTGCTGGGCAGTGATGTCTTTGAGGAGCCAATGTCAGGCATGAGTGAGGCTGGACTCCCTCAG

AGCCCTGACGACTCAGACAGCAGCTATGGTTCCCACTCCACTGACAGCCTCATGGGGTCCTCCCCTGTGTTCAATCAGCGCTGCAGGAAGAGGATGAGGA

AGATTTAACTGCAGAGCGCCAGCAGGAAGCCCATGAGTAGTAATTAGACTGTATTCTTAAGTGTAGACCTTTGCTAATGTCAGAGACAGTTCCTAACCTA

GTAACAGTTCACTTTGCGTCGTTTCTGTACTTCTTTAAAACAACTAAGCCACCGTTCGCAGCTGAGTTGTGATACTGACCTGGTAATCAGACCAAAGTAC

TGTCCCGGCTGGTTTTATCTCAGCTCCTCTCAGCCGTGTCTCTGGCACGCTTGAGAGGAGTCATGCCACTTTGATGCTCCTTGCAGAGGTGGGACACTGA

GGTGCTTTGCTTAAATTTCAAAGCTTGCATATATTCATGTAAATATATGCAATATATGACGTCTATAATAGACGTCAGCAATTCATTCGTCTATTTTGTG

TCGTCATTGGGAACCCAGTAGCAAGACAGACAGTAACAGCTAAACTTAAGTCCATCAGTCAGAGTTCAAACTATTCATGCTACTCAGGCCTCTTACAAAG

TGAGAGCCGTGGGGACAGCTGTTACCCTTATGCAGCTGTCCCCAGAGTTCTTTCTTTTCTAGATTATTCCAGCCAGCCTCGTCATTTTTACTTTCCATAT

GCTCTTGTGCTGACCCAGACTTTTTTTTTTTTCGAGGCAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTTGA

ACTCAGAAATCTGCCTGCCTCTGCCTCCCGAGTGCTGGGATTAAAGGCATGTGCCACCCACGCCTGACTTTTGACCCAGACTTTTAAGTATCTTTCACCA

TGCACACGCTTTCACCTTTTCTCCTTGTGAAGGTGGCAAACAGGGCCCACCACAGCTGCCGGGTACGCAGCATCTGGCTTTGCTTCAGAACAGCTGTTGG

TTTGTTTCAGGTGTTTGTTTTGGTTGTTTTGTTTAAAAAGACATTTGAGGATCCAGAGAGATGGGTCAGTGGGTAAAGTCACTTGCAATTTAAGTTTGAT

ACCGGGGACACACATGGTGTAAGGAGAGAACCAACTCCTCCATCATGACACACACACACACACACACACACACATAAAAATAAATTATTTTTGGAAAAAG

TC
Translation
 - UNI23403 - - UNI33054 - MLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRR

LRSLIATAQTQSQQQTEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYR RGKGEPVTELSWHSCRQLLYQAVATILAHTGFEC

ANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHTYMLQ - UNI6606 - ISKQLSEEYERI

VNPEKATEDTKPVKIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPS - UNI6606 - SAEVNASPLWNLAHVKMEP

QESEEGNVSAHGVLGSDVFEEPMSGMSEAGLPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCRKRMRKI
Transcript ENSMUST00000065388
Sequence
AATCAATAAACAAGGCTCCTAGGCTTGACCTAGTCCTCGACTCCGACCTGTCAGAGTCAGGCAGCCGCGTATACCACTCCTGGGGCAGGGCG - UNI23

403 - - UNI33054 - GGAGAGTATTGTCTGTCCTAGAGTTTTGCTAGCACCTTTTTAAAGTGATCTTAGCTTGCTTCTTATGTGGGAACTGCCTAG

ACTTCCTACTTTTCACTGCAGAAGCTTCTGATCTACAGTTGCCAGAGACGGAAGCACACACCTTTAGGAGATCGTTTACATTAAGCTGGAGAGCCCTTCT

CTGCTTGCTCTAAAATGCTGAGGTACTGGGGAGAGATACCAATACCGTCAGGACAGACCAACAGAAGTTCCTTTGATCTGCTCCCACGGGAGTTCCGTCT

GGTGGAAGTCCATGACCCGCCCCTGCACCAGCCCTCAGCCAACAAGCCGAAGCCCCCCACGATGCTGGACATTCCCTCAGAACCGTGTAGCCTCACCATC

CATACCATTCAGTTGATCCAACACAACCGACGCCTGCGCAGCCTTATTGCCACAGCTCAGACCCAGAGTCAGCAGCAGACAGAGGGTGTGAAGGCTGAAG

AGAGTGAACCTCTTCCCTCCTGCCCTGGCTCACCTCCTCTCCCTGATGACCTCCAGCCTTTAGACTGTAAAAATCCCAATGCTCCATTCCAGATCCGGCA

CAGTGACCCAGAGAGTGACTTTTACCG CGGGAAAGGAGAGCCTGTGACAGAGCTGAGCTGGCACTCCTGCCGGCAGCTCCTCTATCAAGCAGTCGCCAC

AATCCTGGCCCACACAGGCTTTGAGTGTGCTAATGAAAGTGTCCTGGAGACCCTAACTGATGTGGCACATGAATACTGCCTCAAGTTCACCAAGCTGCTG

CGCTTTGCTGTCGACCGAGAGGCCCTGCTGGGACAGACTCCTTTCCCTGATGTAATGGAACAGGTGTTCCATGAAGTGGGCATTGGCAGTGTGCTCTCCC

TGCAGAAGTTCTGGCAGCACCGCATCAAGGACTATCACACTTACATGCTACAG - UNI6606 - ATTAGTAAGCAGCTCTCTGAAGAATATGAAAGGA

TTGTGAATCCCGAGAAGGCCACAGAAGACACTAAACCTGTGAAGATCAAGGAAGAGCCTGTGAGCGACATCACATTTCCTGTCAGTGAGGAGCTAGAAGC

GGACCTTGCTTCTGGAGATCAGTCCTTACCCATTGGGGTCCTCGGGGCTCAGAGTGAGCGCTTCCCATCCAACCTGGAGGTGGAGGCTTCGCCACAGGCT

CCAA - UNI6606 - GTGCAGAGGTCAATGCTTCTCCTCTCTGGAACCTGGCTCACGTGAAAATGGAACCTCAAGAAAGTGAAGAAGGCAATGTGTCT

GCGCATGGGGTGCTGGGCAGTGATGTCTTTGAGGAGCCAATGTCAGGCATGAGTGAGGCTGGACTCCCTCAGAGCCCTGACGACTCAGACAGCAGCTATG

GTTCCCACTCCACTGACAGCCTCATGGGGTCCTCCCCTGTGTTCAATCAGCGCTGCAGGAAGAGGATGAGGAAGATTTAACTGCAGAGCGCCAGCAGGAA

GCCCATGAGTAGTAATTAGACTGTATTCTTAAGTGTAGACCTTTGCTAATGTCAGAGACAGTTCCTAACCTAGTAACAGTTCACTTTGCGTCGTTTCTGT

ACTTCTTTAAAACAACTAAGCCACCGTTCGCAGCTGAGTTGTGATACTGACCTGGTAATCAGACCAAAGTACTGTCCCGGCTGGTTTTATCTCAGCTCCT

CTCAGCCGTGTCTCTGGCACGCTTGAGAGGAGTCATGCCACTTTGATGCTCCTTGCAGAGGTGGGACACTGAGGTGCTTTGCTTAAATTTCAAAGCTTGC

ATATATTCATGTAAATATATGCAATATATGACGTCTATAATAGACGTCAGCAATTCATTCGTCTATTTTGTGTCGTCATTGGGAACCCAGTAGCAAGACA

GACAGTAACAGCTAAACTTAAGTCCATCAGTCAGAGTTCAAACTATTCATGCTACTCAGGCCTCTTACAAAGTGAGAGCCGTGGGGACAGCTGTTACCCT

TATGCAGCTGTCCCCAGAGTTCTTTCTTTTCTAGATTATTCCAGCCAGCCTCGTCATTTTTACTTTCCATATGCTCTTGTGCTGACCCAGACTTTTTTTT

TTTTCGAGGCAGGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTTGAACTCAGAAATCTGCCTGCCTCTGCCTCC

CGAGTGCTGGGATTAAAGGCATGTGCCACCCACGCCTGACTTTTGACCCAGACTTTTAAGTATCTTTCACCATGCACACGCTTTCACCTTTTCTCCTTGT

GAAGGTGGCAAACAGGGCCCACCACAGCTGCCGGGTACGCAGCATCTGGCTTTGCTTCAGAACAGCTGTTGGTTTGTTTCAGGTGTTTGTTTTGGTTGTT

TTGTTTAAAAAGACATTTGAGGATCCAGAGAGATGGGTCAGTGGGTAAAGTCACTTGCAATTTAAGTTTGATACCGGGGACACACATGGTGTAAGGAGAG

AACCAACTCCTCCATCATGACACACACACACACACACACACACACATAAAAATAAATTATTTTTG
Translation
 - UNI23403 - - UNI33054 - MLRYWGEIPIPSGQTNRSSFDLLPREFRLVEVHDPPLHQPSANKPKPPTMLDIPSEPCSLTIHTIQLIQHNRR

LRSLIATAQTQSQQQTEGVKAEESEPLPSCPGSPPLPDDLQPLDCKNPNAPFQIRHSDPESDFYR RGKGEPVTELSWHSCRQLLYQAVATILAHTGFEC

ANESVLETLTDVAHEYCLKFTKLLRFAVDREALLGQTPFPDVMEQVFHEVGIGSVLSLQKFWQHRIKDYHTYMLQ - UNI6606 - ISKQLSEEYERI

VNPEKATEDTKPVKIKEEPVSDITFPVSEELEADLASGDQSLPIGVLGAQSERFPSNLEVEASPQAPS - UNI6606 - SAEVNASPLWNLAHVKMEP

QESEEGNVSAHGVLGSDVFEEPMSGMSEAGLPQSPDDSDSSYGSHSTDSLMGSSPVFNQRCRKRMRKI

For any suggestions or comments, please send an email to unitrap@crg.es