Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053166 (Cdh22)
Chromosomal location
Chr 2: 164937012 - 165060353 (-)
Description
cadherin 22 Gene [Source:MGI (curated);Acc:Cdh22-001]
RefSeq_dna
NM_174988 
RefSeq_peptide
NP_778153.2 
UniGene
Mm.151819 
MGI
MGI:1341843 
Uniprot/SWISSPROT
Q9WTP5 
Uniprot/SPTREMBL
Q14DP7 
Human Ortholog
ENSG00000149654 (CDH22)
Omim not available
UniTrap UNI22107
Vector Insertion
Chr 2: 164960821 - 164967553
Public Clones not available
Private Clones OST308284 (lexicon) OST212140 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065438
Sequence
GGCTCGGCGCTGCTCGGCGCTCCTGCCCGGCGGGCGCTGCATTCTCCGAGTCTCCACCAGAGGCTGCGGGAGGAAGGAAGGGATCCGTCCCTTGCACACT

TCCCCCCTAGTCAGACACGCACACTCCCTCGCTCTCTCGCTCCTCCACACACGCGCGCACTCGCCGCCGCGGCTCCCCCTCTCGCTCCCGCTCTCCCTCG

GCTCCTCCGAGCGGACGCCAGAGCCGGACCTGGCTGTGATCCTGCCGCTTGCTGGCGTCCCAAGGCGCGGACCAGGGTGCAGTCCGGCCGCTCCCCAAG 

GTTCCCGATGGCTCTGGATGACCCCTAGTCCCAGAAGGACTCCAAGATCCTTTTGCCTTCGCTGATCACACCGTCTGGGCGCAGGGACCATGGCACAAGC

CCTATTCAGGAGCAGCTGCCAGGCTGCCTGGTGACTGGACCTGGGGCTTCAGCGAGGGGGGCGCGGGCCAGGACCGGGTGTCCATGCCCGGATGCGGCCG

CGCCCCCTCCCAGTCCAGCCCGGCATCCCCGAGGCTGAGGTCATCATGTGACGCAGCACCGCTGCGGTGCCTCTGGTCCATGCTCAGGGGCTTGGCCAGC

GCCATCAAGCATGAGGCCACGGCCAGAAGGAGCGCTCCGGGCGGGGGCTGCGCTGTCGCCTGTGCTGCTGTTTCTGCTACTGCTACCGCTGCTGGGGCAC

CTGTGGGCCGCAAGCACACCTGCCCCGTCCTCTTTGTCACCTGGGGCTCAGGAGGACAACCAGCTGGGTGCAGGCCGAGTGAAGCGCGGTTGGGTGTGGA

ACCAGTTCTTCGTGGTGGAGGAGTACACGGGGACAGAACCCCTGTACGTGGGCAAG ATCCACTCGGATTCTGACGAAGGGGACGGGACCATCAAGTACA

CCATCTCGGGCGAGGGTGCAGGGACCATCTTCCTGATTGACGAGTTGACAGGTGACATCCATGCCACGGAGCGCCTGGACCGGGAGCAGAAAACCTTCTA

CACACTCCGGGCCCAAGCCAGGGATCGAGCCACCAACCGTCTGCTGGAGCCCGAGTCGGAGTTCATCATCAAAGTACAGGACATCAACGACAGTGAACCA

CGCTTTCTCCACGGCCCCTACATTGGCAGTGTGGCCGAGCTGTCACCTACAG GCACGTCCGTGATGCAGGTGATGGCCTCTGATGCAGACGACCCTACT

TACGGCAGCAGTGCCCGGCTGGTGTACAGTGTGCTGGACGGCGAGCACCACTTCACAGTGGACCCCAAGACAG GTGTGATCCGGACAGCCGTGCCTGAC

CTCGACCGTGAGAGCCAGGAACGCTACGAGGTGGTTATTCAAGCCACAGACATGGCAGGCCAGCTGGGTGGCCTCTCAGGTTCCACTACAGTCACCATCG

TGGTTACTGACGTCAACGACAACCCACCCCGCTTCCCACAAA AGATGTACCAGTTCAGCATACAGGAGTCAGCCCCCATCGGTACGGCTGTGGGCCGCG

TGAAGGCCGAGGACTCAGATGTGGGCGAGAACACGGACATGACTTATCACCTGAGAGAAGAGAGCGGCAGCGGAGGAGACGCGTTCAAGGTCACCACGGA

CAGCGACACTCAGGAAGCCATCATAGTGGTGCAGAAG CACCTGGACTTTGAGTCGCAGCAGGTCCACACAGTGGTGCTGGAAGCCCTCAACAAGTTTGT

GGACCCCCGCTTCGCCGACCTAGGCACATTCCGAGACCAGGCAATCGTGCGCGTGGCCGTGACCGATGTGGATGAACCCCCCGAGTTCCGGCCACCCTCC

GGCCTACTGGAGGTGCAGGAGGACGCGCAGGTGGGCTCCCTGGTCGGCGTGGTGACGGCGCGGGACCCCGACGCCGCCAACCGGCCCGTCCG - UNI22

107 - GTACGCCATTGATCGGGACTCGGATTTGGAGCAGATCTTTGACATCGATGCGGACACTGGTGCCATCGTGACTGGCAAGGGGCTGGACCGTGAA

ACCGCTGGCTGGCACAACATTACTGTGCTGGCCATGGAAGCAG ACAATCATGCTCAGCTATCTCGGGCATCCCTACGGATCCGAATCCTGGACGTGAAC

GACAATCCCCCGGAGCTCGCTACACCCTACGAGGCAGCTGTGTGTGAAGACGCCAAGCCAGGCCAG CTCATCCAAACCATCAGTGTGGTGGACAGAGAC

GAGCCCCAGGGCGGCCACCGCTTCTATTTCCGTCTGGTACCAGAAGCACCTAGCAACCCTCATTTCTCTCTGCTGGACATTGAAG ATAACACAGCTGCG

GTGCACACGCAGCACGTGGGCTTCAACCGGCAAGAGCAGGACGTGTTCCTCCTGCCCATCCTCGTTGTGGACAGCGGGCCACCCACCCTGAGCAGCACGG

GCACCCTCACCATCCGCATCTGCGGCTGTGACAGCTCCGGTACCATCCAGTCCTGCAACACCACCGCCTTTGTCATGGCTGCCTCCCTCAGCCCCGGCGC

ACTCATCGCTCTCTTGGTCTGTGTTCTCATCCTGGTTG TTCTTGCTCTGCTGATCCTCACTCTCAGGCGGCACCACAAGAGCCATCTGAGCTCAGACGT

GGATGAAGACATGCGGGACAATGTGATCAAATACAACGACGAGGGCGGCGGCGAGCAGGACACCGAGGCCTATGACATGTCAGCGCTACGGAGCCTCTAC

GATTTTGGGGAGCTCAAGGGTGGCGACCCGGGCGGGGGCGCGGCCAGTCCCCCGCAGGCTGCTTCCTCTTCTGAGCGCCACTCGCTGCCTCGGGGGCCGT

CGAGCCCCGAGCCGGACTTCTCGGTGTTCAGGGACTTCATCAGCCGCAAGGTGGCGCTGGCGGACGCGGACCTATCGGTGCCTCCCTACGACGCCTTCCA

GACCTACGCGTTCGAGGGCGCGGGCTCGCCGGCCGCCTCGCTCAGCTCGCTGCACAGCGGCTCGACCGGCTCGGAGCAGGACTTCGCCTTTCTCCGCGCC

TGGGGCCCGCGCTTCCGACCGCTGGCCGCGCTCTACGCCGGCCACCGCGGGGACGACGAGGCCCCGGCCTCCTAGCCCCAGCCTGCCCAGTCGGGCAGCG

CAGCCCGACGGGAGGGGATCTGCAGGGTCCCTGCTCCGCGACACGTTCCCAGGGGTGTATCTTGCGGAAGACTCAGGGGCGCGGCAGTGATGACCAATGT

CAGGAAAAAGGAGGGGAACCTGGCCTGTGCGGATCTGGGGTTGGACAGGACCACGGTAGGGGAACCCGGCTCTGGGAAAGGACAATGGGAGGGGAAAGCA

GAGGAGGGCGCTGCTGCCATGCCCACCCCAAGGCTTTCTGGCATCCAATTAAAGATGAAGGAAGGGCTGGTCATTTACTAAGCACCTACTGTGTGCTGAG

AGCTACCTGGAGACCAACTGCATTGTTGGAAAAGCTATGAGGTGGAGTCTTGAAGGTGTCAGATGGGGAAGCTCCCCCAGAGAAGTGGATGTGACTTGCT

CAGGGACACCCAGGCAGCAAGTGGTGGAGCCTCTGGCACTGACCGGCTGTCTGGCCTTGGGCACGTCATGTCATTTCTCTGGGCCTCAGTTTCCTCATCT

GTCAAATGAGGTTGATAACAGCACCTACCTCGAAGATTTGAGAGGATCAAAAGGGTTCATGTGTCAAGTTGTTGGGCGGTGCCTGGCACAGAGTAGGTGT

TCAATAAATGCTCGCCTTTGT
Translation
 MRPRPEGALRAGAALSPVLLFLLLLPLLGHLWAASTPAPSSLSPGAQEDNQLGAGRVKRGWVWNQFFVVEEYTGTEPLYVGK IHSDSDEGDGTIKYTI

SGEGAGTIFLIDELTGDIHATERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQDINDSEPRFLHGPYIGSVAELSPTG GTSVMQVMASDADDPT

YGSSARLVYSVLDGEHHFTVDPKTG GVIRTAVPDLDRESQERYEVVIQATDMAGQLGGLSGSTTVTIVVTDVNDNPPRFPQK KMYQFSIQESAPIGTA

VGRVKAEDSDVGENTDMTYHLREESGSGGDAFKVTTDSDTQEAIIVVQK HLDFESQQVHTVVLEALNKFVDPRFADLGTFRDQAIVRVAVTDVDEPPEF

RPPSGLLEVQEDAQVGSLVGVVTARDPDAANRPVR - UNI22107 - RYAIDRDSDLEQIFDIDADTGAIVTGKGLDRETAGWHNITVLAMEAD DNH

AQLSRASLRIRILDVNDNPPELATPYEAAVCEDAKPGQ LIQTISVVDRDEPQGGHRFYFRLVPEAPSNPHFSLLDIED DNTAAVHTQHVGFNRQEQDV

FLLPILVVDSGPPTLSSTGTLTIRICGCDSSGTIQSCNTTAFVMAASLSPGALIALLVCVLILVV VLALLILTLRRHHKSHLSSDVDEDMRDNVIKYND

EGGGEQDTEAYDMSALRSLYDFGELKGGDPGGGAASPPQAASSSERHSLPRGPSSPEPDFSVFRDFISRKVALADADLSVPPYDAFQTYAFEGAGSPAAS

LSSLHSGSTGSEQDFAFLRAWGPRFRPLAALYAGHRGDDEAPAS

For any suggestions or comments, please send an email to unitrap@crg.es