Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053192 (Mllt11)
Chromosomal location
Chr 3: 95023059 - 95032225 (-)
Description
myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11 Gene [Source:MGI (curated);Acc:Mllt11-001]
RefSeq_dna
NM_019914 
RefSeq_peptide
NP_064298.1 
UniGene
Mm.473724 
MGI
MGI:1929671 
Uniprot/SWISSPROT
P97783 
Uniprot/SPTREMBL
Q543U0 
Human Ortholog
ENSG00000213190 (MLLT11)
Omim not available
UniTrap UNI16036
Vector Insertion
Chr 3: 95024386 - 95032005
Public Clones (sanger) E021G07 (ggtc) E017D09 (ggtc) 5SE287F02 (ggtc) IST14484A3 (tigm)
IST14498E10 (tigm) IST12622B2 (tigm) IST12237D6 (tigm) IST14698F12 (tigm)
IST12463E7 (tigm) IST14534A4 (tigm) IST14344F6 (tigm) IST14637D1 (tigm)
IST14621G8 (tigm) IST14888A8 (tigm) IST14578A5 (tigm)
Private Clones OST467464 (lexicon) OST300668 (lexicon) OST299465 (lexicon) OST293141 (lexicon)
OST286215 (lexicon) OST230404 (lexicon) OST230287 (lexicon) OST224932 (lexicon)
OST208519 (lexicon) OST180270 (lexicon) OST174756 (lexicon) OST171813 (lexicon)
OST170980 (lexicon) OST169504 (lexicon) OST169455 (lexicon) OST134381 (lexicon)
OST133639 (lexicon) OST132460 (lexicon) OST119461 (lexicon) OST107339 (lexicon)
OST91909 (lexicon) OST91505 (lexicon) OST86039 (lexicon) OST65871 (lexicon)
OST32744 (lexicon) OST24317 (lexicon) OST16669 (lexicon) OST6109 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065482
Sequence
GGCGGGGAGTGCTTCCGCCCTTGCTAGGAGGGGCTGCATTGCAGGGGAGACCCAGCGGCAGATTCTGTCACAGACGAGGGAGAAGGCGTGAGGAGACAAA

GCCGTCACATCCGCGACAGCTTCCTTCAGCAGCCTCCTCCTCTCCAGTCCAGAGCCGACCCCCGAGCCCCTGAGGCATCCCTTCCGTCTTCGGAACACCC

TAGTCATTCATTGCTAACAG - UNI16036 - GGGATCATGAGGGACCCTGTAAGTAGCCAGTACAGCTCCTTTCTTTTCTGGAGGATGCCCATCCCA

GAACTGGATCTGTCGGAGCTGGAAGGCCTGGGCCTGTCAGATACACCTACCTACGAGAGCAAGGATAGCAGCAGCGTTGGCAAAATGAACGGGCAGGCAT

CTGGGACGGAGCAGAAGAACCCTGAAGGTGACCCCCTCCTTGAGTACAGCACCTTCAACTTCTGGAGAGCGCCTATTGCCAGCATCCACTCTGTCGACCT

GGACTTGCTTTAAGGCCAAGATCTCTCTCCCACCCCGTACCTTCATTATCTTCCCTCTTAAGTCCCTTCCTCTCTAAGCCTTCCACTTTAATCTTGTTCT

CTTCCCTCTATTGTGCTGGTGGTGCTGATGAATCTGCCAATTGAATTGTAGGTTTGTATGTATGTACGTACTTATTTATCTATCTATATTTATTTATTTA

TTTATTTATCTGCCTACTCCGTTTCTCTCAAAAGCCCTCTAGGCACAAAGTCAAGGGTTTAATCAATGGAGTACTAGATCATAGGATTTCCTCCCGTCAG

CCCGGAGAATATTAACTAATCCCAGAAAAGAATCACCCTTATTTGAGGCACCACAGAGAGGTACAGTTGTGCAAAATGGGAGACCAATTATTTTGTTTGT

TTGTTACATTTTAATCAACTTCAAAGATTACTTGAGCCTCCCTAATGTCCTCTACCAGGCCAGTAAGCAAATACTGCTTCAAGAAGTAATGAGAACCTGG

AAGTTTTGAGACACTTTCTACAAAACAGGATTTCTAAAAGGCTAAGATAAGAAATGCTGCTGCTGCTTACAATGCATTCTCTTCCCCAGAAACACGCAGG

CAGTTAAAGGTGGGAAACAAAGGAGTGGGATGAGGAAAAACATCGCACCGTTTCAGAGGTAGCTCCTTTAATATCCAGCTCTGCTTCCAGCTGTGGGTAG

AAATGCTCAGAAAATCAGATTTGAGTCTTCACAGGGAAACTTCACTATGAGGATAATTCCTAAAAGACAAAAGATGTATCTGATCTAAAGAAACACCAGA

GTATTATTAGGGGAATTTATATAAAATTGTGATTTTGTCATGGAACAGGCAGATGTTTTGGTCCTAAGTATTTTAGCTTTGCCTTTCTGTAGTTGCAGTA

TGTGATAGGAATCAGTGATTCCTGACACAGTTCTTTGGCCGCCATAAGACCGTGAAGTAAGCAGTTATGTTCAGACCCTACCCGTCCCCATTCCTTCCAA

AGCTATTGCAGATGAATTGCGGAGCTGTTTATTCATTTATGGAATAAAGACGTTAAATCCT
Translation
 - UNI16036 - MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTPTYESKDSSSVGKMNGQASGTEQKNPEGDPLLEYSTFNFWRAPIASIHSVD

LDLL

For any suggestions or comments, please send an email to unitrap@crg.es