Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053211 (Zfy1)
Chromosomal location
Chr Y: 61650 - 133852 (-)
Description
zinc finger protein 1, Y linked Gene [Source:MGI Symbol;Acc:MGI:99212]
RefSeq_dna
NM_009570 
RefSeq_peptide
NP_033596.3 
UniGene
Mm.4324 Mm.411381 
MGI
MGI:99212 
Uniprot/SWISSPROT
P10925 
Human Ortholog
ENSG00000067646 (ZFY)
Omim not available
UniTrap UNI31902
Vector Insertion
Chr Y: 96292 - 133620
Public Clones (sanger) IST12607B12 (tigm) IST13415B4 (tigm) IST12179G10 (tigm) IST13333A9 (tigm)
IST14752G8 (tigm) IST14508H10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9937
Vector Insertion
Chr Y: 75587 - 96292
Public Clones (sanger) XD005 (baygenomics) XD045 (baygenomics) IST14433D6 (tigm)
IST10991B8 (tigm) IST14362C3 (tigm) IST11584F2 (tigm) IST14282D6 (tigm)
IST12482B7 (tigm) IST13840F1 (tigm) IST14476E9 (tigm) IST14473G5 (tigm)
IST14011H8 (tigm) IST13431H12 (tigm) IST12949E2 (tigm) IST14100C7 (tigm)
IST12143E6 (tigm) IST14148F3 (tigm) IST13288G11 (tigm) IST10767G5 (tigm)
IST14807H6 (tigm) IST14038C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31898
Vector Insertion
Chr Y: 69370 - 71612
Public Clones IST14517H8 (tigm) IST10324H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065545
Sequence
GAACAGAAAGACTGGTGAACATCAAACGGCCGTTACTCAATTTCAGGCATTCTGGGAACGGAAAGACTGGTGAGCATCAAACGGTCGTTACTCATTTTCA

GGTGTTCTGGGTTTTCAGGCGTTCTGGGCTGTAAG - UNI31902 - AGACCGGCCCAGTACTCTGAAGTCTGCAGTACTTGTCGTCATTGCCTACCC

CTCTACACTGGTCTG - UNI31902 - GAGCTGACTTAGTAAGAACTGAAGGCCATGGATGAAGATGAAATTGAATTGACCCCAGAAGAAGAAAAGTC

ATTCTTTGATGGAATAG - UNI9937 - - UNI31902 - GAGCTGATGCAGTACACATGGATAGTGACCAGATTGTTGTGGAAGTACAAGAAACTG

TTTTTTTAGCTAATTCAGATGTAACTGTGCATAATTTTGTTCCTGATAATCCAGGCTCAGTTATAATTCAAGATGTTATTGAAAATGTTCTTATTGAAGA

TGTTCACTGTTCACATATTTTAGAAGAAACAGATATATCTGACAATGTCATTATTCCTGAGCAAGTTCTCAATTTAGGTACAGCAGAAGAAGTGTCTTTA

GCACAGTTCTTAATTCCAGACATTTTAACATCTGGTATTACGTCAACCTCATTGACTATGCCTGAACATGTCTTGATGAGTGAAGCTATACATGTGTCTG

ATGTAGGACATTTTGAACAAGTGATTCATGATAGCCTTGTAGAAACAGAAGTCATCACTGATCCTATAACAGCTGACACTTCAGATATACTGGTAGCAGA

TTGTGTTTCTGAAGCAGTCTTAGATTCCAGTGGGATGCCTCTGGAGCAGCAAGATAATGACAAAATCAACTGTGAGGATTATCTGATGATGTCTT - UN

I31898 - TGGATGAACCTAGCAAAGCAGATCTTGAAGGTTCCTCTGAAGTTACCATGAATGCAGAGTCAGGAACTGATTCTTCTAAATTGGATGAAGC

ATCTCCAGAAGTTATCAAGGTGTGCATTCTTAAAGCTGACTCAGAAGTGGATGAATTAG - UNI31898 - GAGAAACTATACACGCAGTAGAGAGTG

AGACCAAAAATGGCAATGAAGCTGAAGTCACAGATCAGAGCACTAGCATTCGTGTTCCCAGAGTCAACATTTATATGTCAGCCAGTGATTCTCAAAAGGA

AGAAGAAGATACTG - UNI31898 - AAGTAATTGTAGGAGATGAAGATGCTGGTGGCACAGCTGCAGATACTCCTGAGCATGAGCAACAGATGGATG

TCAGTGAAATAAAAGCAGCTTTCCTACCTATTGCATGGACAGCAGCTTATG ATAATAATTCTGATGAAATTGAAGACCAGAATGTCACTGCCAGTGCTC

TCTTAAACCAAGATGAGTCTGGTGGCCTTGACAGAGTACCAAAACAAAAATCAAAAAAGAAAAAAAGACCTGAATCCAAACAGTACCAGTCAG CAATAT

TTGTTGCTCCTGATGGACAAACTTTACGTGTCTATCCTTGCATGTTTTGTGGGAAAAAATTTAAGACCAAAAGGTTTTTGAAAAGACATACAAAAAACCA

TCCTGAATACCTTGCTAATAAAAAATATCACTGTACTGAGTGTGATTACAGTACCAACAAGAAGATAAGCTTACATAATCACATGGAGAGCCACAAGCTA

ACCATTAAGACAGAAAAGACCACTGAATGTGATGACTGTAGGAAGAATCTTTCTCATGCTGGGACTTTGTGTACTCACAAAACAATGCATACAGAAAAAG

GAGTCAACAAAACATGTAAGTGTAAGTTCTGTGACTATGAAACAGCTGAACAGACATTATTGAATCACCACCTTTTGGTGGTCCACAGGAAGAAATTTCC

TCACATTTGTGGAGAATGTGGTAAAGGTTTCCGTCACCCATCAGCACTCAAAAAGCACATACGAGTTCACACAGGAGAGAAGCCCTATGAATGTCAGTAT

TGTGAGTACAAGTCTGCAGACTCTTCCAACTTGAAAACTCATATAAAATCTAAGCATAGTAAAGAGATACCACTGAAGTGTGGCATCTGTCTCCTGACTT

TCTCAGATAACAAAGAGGCTCAGCAACATGCCGTTCTGCACCAAGAAAGCAGAACACATCAATGTTCACATTGCAACCATAAGAGTTCAAACTCAAGTGA

TTTAAAGCGACACATAATTTCCGTTCACACAAAGGCGTATCCTCATAAATGTGACATGTGCAGCAAAGGATTTCATAGGCCTTCAGAACTCAAGAAGCAT

GTGGCTACCCATAAAAGTAAAAAAATGCACCAATGTAGACACTGTGACTTTAATAGTCCAGATCCATTTCTGCTTAGTCACCATATTCTCTCAGCTCACA

CAAAGAATGTTCCATTCAAGTGTAAGAGATGTAAAAAGGAATTTCAACAACAGTGTGAGCTTCAAACGCATATGAAGACCCACAGTAGCCGAAAAGTCTA

TCAGTGTGAGTACTGTGAATATAGCACCAAAGATGCCTCAGGTTTTAAGCGCCACGTTATCTCCATTCATACGAAAGACTATCCTCACAGCTGTGACTTC

TGCAAGAAAGGATTCCGGAGACCCTCGGAAAAGAATCAACACATAATGCGACATCATAAAGTTGGCCTGCCCTAAGTGTATAATCCTAACATATAGGGAT

ATTGGCATTGAGACAGTAAATTCATTTTAAAAGCAGGCATCCTTGTTCACATCCAATATCATGAATTTGTCAAGTGAATATAAAGATGATATTGCGCCTA

TTTGACTTTATGTTTTATTAAATAGGGTATTCAATATATCCTTTACAGACTGACAAAGTGTGAGAAATAAATTTTAACAACAC
Translation
 - UNI31902 -  - UNI31902 - MDEDEIELTPEEEKSFFDGIG - UNI9937 - - UNI31902 - GADAVHMDSDQIVVEVQETVFLANS

DVTVHNFVPDNPGSVIIQDVIENVLIEDVHCSHILEETDISDNVIIPEQVLNLGTAEEVSLAQFLIPDILTSGITSTSLTMPEHVLMSEAIHVSDVGHFE

QVIHDSLVETEVITDPITADTSDILVADCVSEAVLDSSGMPLEQQDNDKINCEDYLMMSL - UNI31898 - LDEPSKADLEGSSEVTMNAESGTDSS

KLDEASPEVIKVCILKADSEVDELG - UNI31898 - GETIHAVESETKNGNEAEVTDQSTSIRVPRVNIYMSASDSQKEEEDTE - UNI31898 -

 EVIVGDEDAGGTAADTPEHEQQMDVSEIKAAFLPIAWTAAYD DNNSDEIEDQNVTASALLNQDESGGLDRVPKQKSKKKKRPESKQYQSA AIFVAPD

GQTLRVYPCMFCGKKFKTKRFLKRHTKNHPEYLANKKYHCTECDYSTNKKISLHNHMESHKLTIKTEKTTECDDCRKNLSHAGTLCTHKTMHTEKGVNKT

CKCKFCDYETAEQTLLNHHLLVVHRKKFPHICGECGKGFRHPSALKKHIRVHTGEKPYECQYCEYKSADSSNLKTHIKSKHSKEIPLKCGICLLTFSDNK

EAQQHAVLHQESRTHQCSHCNHKSSNSSDLKRHIISVHTKAYPHKCDMCSKGFHRPSELKKHVATHKSKKMHQCRHCDFNSPDPFLLSHHILSAHTKNVP

FKCKRCKKEFQQQCELQTHMKTHSSRKVYQCEYCEYSTKDASGFKRHVISIHTKDYPHSCDFCKKGFRRPSEKNQHIMRHHKVGLP

For any suggestions or comments, please send an email to unitrap@crg.es