Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053219 (Raet1c)
Chromosomal location
Chr 10: 21878375 - 22093945 (+)
Description
retinoic acid early transcript 1E Gene [Source:MGI Symbol;Acc:MGI:2675273]
RefSeq_dna
NM_198193 
RefSeq_peptide
NP_033044.1 NP_937836.1 
UniGene
Mm.440891 
MGI
MGI:109431 MGI:2675273 
Uniprot/SWISSPROT
O08604 Q9CZQ6 
Uniprot/SPTREMBL
A2RSA1 A2RSZ5 
Human Ortholog
not available
Omim not available
UniTrap UNI1396
Vector Insertion
Chr 10: 21878525 - 21891809
Public Clones CJ0023 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15201
Vector Insertion
Chr 10: 21903721 - 22093582
Public Clones PST9934-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060105
Sequence
CACCTTTCCTGACACTATTGCCAATAGTCCCTGAGGGCGCAGCTGTTG CCACAGTCACATCTGTCAGAAGAAACCATGGCCAAGGCAGCAGTGACCAAG

CGCCATCATTTTATGATTCAGAAGCTGTTAATTCTACTGAGCTATGGATACACCAACGGGCTGGATG ATGCACACTCTCTTAGGTGCAACTTGACCATC

AAGGATCCTACCTCAGCAGACCTTCCCTGGTGTGACGTGAAGTGCTCAGTGGATGAAATAACTATCCTCCATTTAAATAACATAAACAAGACCATGACTT

CAGGTGACCCAGGGAAGATGGCAAATGCCACTGGCAAATGTTTGACACAACCTCTGAACGATTTGTGCCAGGAGTTGAGGGACAAGGTGTCTAACACCAA

AGTGGACACTCACAAGACCAATG GTTACCCACATTTACAAGTCACCATGATTTATCCGCAAAGCCAGGGCCAAACTCCTAGTGCCACCTGGGAATTCAA

CATCAGTGACAGTTACTTCTTCACCTTCTACACAGAGAATATGAGCTGGAGATCAGCTAATGATGAATCAGGGGTTATCATGAATAAATGGAAAGATGAT

GGGGACCTTGTGCAACAATTGAAATACTTCATACCCCAATGCAGACAGAAAATTGATGAATTCTTAAAGCAGTCCAAGGAAAAGCCAA GATCAACCTCA

AGGTCCCCCAGTATCACCCAGCTTACATCAACTTCCCCGCTTCCACCTCCCAGCCACTCTACTTCTAAGAAAGGATTTATCTCTGTGGGACTCATCTTCA

TATCTTTATTATTTGCATTTGCATTTGCGATGTGAAGAGGAAATATTATACCCAAGGAG - UNI15201 - AGGCCAGAGGAGGGCATCGGATCCTGT

GGAACTGGAGTTACAGTTGGTTTCCAATACTGGGAACTGAATCCAGGACCTCTCCAAGAACAGCAAGTGCTCTTTGCTACTGAGCCTTATCTCCCTCCTC

TAATACATTTCTTAATAAAAGAATATAGTTTGAATATTATTAAACCCAGGGCAAGTCCCACAGTAAGCTTCACAATAAAGTTGATTGTTTCAGAATCAAA

AAGGAAAACACATTTTAAAATGACTGTCATGGCCAGTTATCACATCGTTTGTAGCAATGTATGATGGAGGACGTCCAGGTCCGTCTAAAAAAATGCCAGG

CAATACAGCAACATCTAATAAAACTGGTAAATTTAA
Translation
 MAKAAVTKRHHFMIQKLLILLSYGYTNGLDD DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDLC

QELRDKVSNTKVDTHKTNG GYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDEF

LKQSKEKPR RSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGLIFISLLFAFAFAM - UNI15201 - 
Transcript ENSMUST00000065527
Sequence
AGAGCTATTGCGGAGG ATTTCAGAGGCTGCAGTTCAAGACACCAACTTTTTTCTTTCTTCACCTTTCCTGACACTATTGCCAATAGTCCCTGAGGGCGC

AGCTGTTG CCACAGTCACATCTGTCAGAAGAAACCATGGCCAAGGCAGCAGTGACCAAGCGCCATCATTTTATGATTCAGAAGCTGTTAATTCTACTGA

GCTATGGATACACCAACGGGCTGGATG ATGCACACTCTCTTAGGTGCAACTTGACCATCAAGGATCCTACCTCAGCAGACCTTCCCTGGTGTGACGTGA

AGTGCTCAGTGGATGAAATAACTATCCTCCATTTAAATAACATAAACAAGACCATGACTTCAGGTGACCCAGGGAAGATGGCAAATGCCACTGGCAAATG

TTTGACACAACCTCTGAACGATTTGTGCCAGGAGTTGAGGGACAAGGTGTCTAACACCAAAGTGGACACTCACAAGACCAATG GTTACCCACATTTACA

AGTCACCATGATTTATCCGCAAAGCCAGGGCCAAACTCCTAGTGCCACCTGGGAATTCAACATCAGTGACAGTTACTTCTTCACCTTCTACACAGAGAAT

ATGAGCTGGAGATCAGCTAATGATGAATCAGGGGTTATCATGAATAAATGGAAAGATGATGGGGACCTTGTGCAACAATTGAAATACTTCATACCCCAAT

GCAGACAGAAAATTGATGAATTCTTAAAGCAGTCCAAGGAAAAGCCAA GATCAACCTCAAGGTCCCCCAGTATCACCCAGCTTACATCAACTTCCCCGC

TTCCACCTCCCAGCCACTCTACTTCTAAGAAAGGATTTATCTCTGTGGGACTCATCTTCATATCTTTATTATTTGCATTTGCATTTGCGATGTGAAGAGG

AAATATTATACCCAAGGAG AGGCCAGAGGAGGGCATCGGATCCTGTGGAACTGGAGTTACAGTTGGTTTCCAATACTGGGAACTGAATCCAGGACCTCT

CCAAGAACAGCAAGTGCTCTTTGCTACTGAGCCTTATCTCCCTCCTCTAATACATTTCTTAATAAGAGAATATACTCTGAATATTATTAAACCCAGGGCA

AGTCCCACAGTAAGGTTCACAATAAAGTTTATTGTTTCAGAATCAAAAAGGAAAACACATTTTAAAATGACTGTCATGGCCAGTTATCACATCGTTTGTA

GCAATGTATGATTGAGGACGTCCAGGTCCATCTAAAAAAATGCCAGGCAATACAGCAACATCTAATAAAACTGGTAAATT
Translation
  MAKAAVTKRHHFMIQKLLILLSYGYTNGLDD DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMANATGKCLTQPLNDL

CQELRDKVSNTKVDTHKTNG GYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQLKYFIPQCRQKIDE

FLKQSKEKPR RSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGLIFISLLFAFAFAM 
Transcript ENSMUST00000105523
Sequence
CTTCCGCCCTCCGCCATTGTGTCCATCCCCTGCCCGCAGAGCGCCGCTTGCCCGGGCCGCTGTAGTCAGTTACCTGCTCCGCCGGGCGAACACGTGCGGG

GGCAGACAGACACTCCAGCTTCGCAGGAGGCCGGCGCCCCTGCACCGCAG - UNI1396 - GTGCAGCTCACAGCTGGACCCACAGACCAAATGGCAC

ATAAGCAACTACTTGAAAACAGCTGGGAGCACTCTAGCAAGAAGCTCAAAGGACAGAGAAG TGTGTGCAGAGGTCAGAAACCTGCCTGGAATCCCCTGG

AGCAGCAGTCACAGAAGGTTGTGAGCTGCTCG ATTTCAGAGGCTGCAGTTCAAGACACCAACTTTTTTCTTTCTTCACCTTTCCTGACACTATTGCCAA

TAGTCCCTGAGGGCGCAGCTGTTG CCACAGTCACATCTGTCAGAAGAAACCATGGCCAAGGCAGCAGTGACCAAGCGCCATCATTTTATGATTCAGAAG

CTGTTAATTCTACTGAGCTATGGATACACCAACGGGCTGGATG ATGCACACTCTCTTAGGTGCAACTTGACCATCAAGGATCCTACCTCAGCAGACCTT

CCCTGGTGTGACGTGAAGTGCTCAGTGGATGAAATAACTATCCTCCATTTAAATAACATAAACAAGACCATGACTTCAGGTGACCCAGGGAAGATGGCAA

ATGCCACTGGCAAATGTTTGACACAACCTCTGAACGATTTGTGCCAGGAGTTGAGGGACAAGGTGTCTAACACCAAAGTGGACACTCACAAGACCAATG 

GTTACCCACATTTACAAGTCACCATGATTTATCCGCAAAGCCAGGGCCAAACTCCTAGTGCCACCTGGGAATTCAACATCAGTGACAGTTACTTCTTCAC

CTTCTACACAGAGAATATGAGCTGGAGATCAGCTAATGATGAATCAGGGGTTATCATGAATAAATGGAAAGATGATGGGGACCTTGTGCAACAATTGAAA

TACTTCATACCCCAATGCAGACAGAAAATTGATGAATTCTTAAAGCAGTCCAAGGAAAAGCCAA GATCAACCTCAAGGTCCCCCAGTATCACCCAGCTT

ACATCAACTTCCCCGCTTCCACCTCCCAGCCACTCTACTTCTAAGAAAGGATTTATCTCTGTGGGACTCATCTTCATATCTTTATTATTTGCATTTGCAT

TTGCGATGTGAAGAGGAAATATTATACCCAAGGAG AGGCCAGAGGAGGGCATCGGATCCTGTGGAACTGGAGTTACAGTTGGTTTCCAATACTGGGAAC

TGAATCCAGGACCTCTCCAAGAACAGCAAGTGCTCTTTGCTACTGAGCCTTATCTCCCTCCTCTAATACATTTCTTAATAAGAGAATATACTCTGAATAT

TATTAAACCCAGGGCAAGTCCCACAGTAAGGTTCACAATAAAGTTTATTGTTTCAGAATC
Translation
 - UNI1396 -    MAKAAVTKRHHFMIQKLLILLSYGYTNGLDD DAHSLRCNLTIKDPTSADLPWCDVKCSVDEITILHLNNINKTMTSGDPGKMA

NATGKCLTQPLNDLCQELRDKVSNTKVDTHKTNG GYPHLQVTMIYPQSQGQTPSATWEFNISDSYFFTFYTENMSWRSANDESGVIMNKWKDDGDLVQQ

LKYFIPQCRQKIDEFLKQSKEKPR RSTSRSPSITQLTSTSPLPPPSHSTSKKGFISVGLIFISLLFAFAFAM 

For any suggestions or comments, please send an email to unitrap@crg.es