Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053390 (C920016K16Rik)
Chromosomal location
Chr 17: 33130183 - 33146518 (+)
Description
RIKEN cDNA C920016K16 gene Gene [Source:MGI Symbol;Acc:MGI:2441928]
RefSeq_dna
NM_001045559 
RefSeq_peptide
NP_001039024.1 
UniGene
Mm.413696 Mm.246667 
MGI
MGI:2441928 
Uniprot/SPTREMBL
Q6PFE9 B0V2W3 B0V2W4 
Human Ortholog
not available
Omim not available
UniTrap UNI12607
Vector Insertion
Chr 17: 33138696 - 33138902
Public Clones F036E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075524
Sequence
ATGTTCAGTTGGCTCATTTATATTTACAAATTCTCACAGAAGCAAAATCAGTCGTGCCGTTCGTCCTCCCTCCTCCAGGTTCTTTGTCTATGGCCCAG A

ACTCTGGTGGCTGAGAGGAGTTGTGACTACGGAGATGTCAGTCAGTGTGGAGAAACCCGGCAACGGATTCCAGAGTGTATCATTCGTAGAGACACGCCTC

CTGAAATATCAGTGTGTAAAAACAGTGTGCTTGCTAGAGACATCCTTGTTCATTCCCTCTCAGAAGTGCACCTCAGATGTGAAACTGCAGAGAAACCCTG

TGGGTCTCAGGAATATGTGAAGTGTTGCAAAGAGTCTACTTCTTCTGAGTCCTTTCAGACAAAGCAAAGTCCTCCTCGAGAGACACCCTATCAAAATAAG

CAATCTAATGAAGCCTATAGGAGTCTTAATTCTGACCGGTATTGTGAGCAAATTCACACTGGAGATAAACTCCGTGAATGGAAGCAAGTTGAGAAAGCCT

TCTGGAGGTACAGTTACGGTCAAATATATGAGAGAATCACCATTGGAGAGGAACCATTTGTGTGTAAGCAGTATGGTGAAGCCTTGGTTAATTCTAGTCA

TCTTATTAAACATGAAGTAATTAGCCCTGAAGAAAAATGTTACACATGTAAGCAGTGTGGGAAGGCATTCAGATATTCCTCATCCCTTCAGAACCATGAA

AGAATCCATAGCGGGGAGAGGCCATATGTATGTAAGCAATGTGGAAAAACCTTCATTCGTTCCTATGACCTTCTTATCCATGAAAGAATTCACAGTGGAG

AAAAACCTTACACGTGTGAGCATTGTGGAAAATCTTTCACCCATTATAGCGGCTGGTACAGTCATGAAAGGATTCACACTAGAGAGAAACCCTATGTGTG

CACACAGTGTGGGAAAGCCTTTTCATGCTCTACATCGTTCCGGAGGCATGAAAGAATTCACACTGGAGAGAAACCTTACTCCTGTAAGCACTGTGGGAAA

GCCTTCACCCATTCCAGTGCTCGTTACATTCATGAGCGAATTCACACCGGAGAGAAACCCTACGTTTGTAAGCACTGTGGAAAAGCATTCCTCCGTGCCA

GTCATCTCAACAACCATGAGAGAATTCACACTGGAGAGAAACCCTATATTTGTAAGCATTGTGGGAAAGCCTTCATCCAGCGCGATGCTTGTTATAATCA

CGAAAGAATTCACACTGGAGAGAAACCATATGTATGTAAGGAATGTGGAAAAGCATTTAGGATTTCCACATCCCTTCGTGACCATGAGAGAATTCACACT

GGAGAAAAACCTTACATATGTAATTATTGTGGGAAAGCATTTAGGGTCTCCACATGCCTTCACAAACATGAACGAGCTCATGCTGAAAAGAAACCCAGTG

GGTAGAACTGAAGCCCATATAGATCTTTGATCAACTGTCAGGAAAAGTGTATGCAGGGTCAGTCAGATGGCTCAGGGATAAAAGCACTTGCCCTAAGCTT

GGTAGCCATAGTTGGAACCTCAGAACCCATGTGAAGAGAGAGAACTGAATTTCCAAGGTTTGCCTCTGACTTGTACATATGTGCTGTCATTTGCATGCAT

ACCCTCACATAGATGTATAAAGAAATAGGATAATTTAAAATACCTTTTTAAATTTTGTTTTGTTTTGAGACAGGGTTTCACTGTGCAGCCCCTTGGTTGT

CCTGCAACTCACTCTGCAGACCAGGCTGGCCTTAAACTCAGAGGTCCCCCTGCCTCTGCCTTCCGAGTGTTGAGATTAAAAGTGTGCACGTCCCTGCTGC

CTAGCTTTAAGATCATTTTAATGTTGCTTTTGATTTGTAGTTATTTGTAGTTATGTGTGGGTATGTGCATGTGAGGGCTGGAGCACACAGCAGTCAGAGG

CATCACATTCCCCAGGAGCTGGAGTTACAGGAGCCGGTGAGGTGTCCCATGTGACGGCTGGAAATCCAGCTTGGGTCCTCCGGAGAGCAGTATATTCTGA

GCCATCTTTCTAGTCTCATAGGTGTAATTAAAGACAAATTGGGAAAGAAATAGCTGGAATAGACCTTAAGATGTGTAAATTTGGACACATATGAAATGTG

ATGTTGGATAAAAACGAGTTCCATCAAATGTGCTAAGGCACTTTTTTTTGGAAATTATATTTAATATAAATTATGAACACAGTTCATGAACATTACATAG

GTGTGTGTGCATGGTGTCCACATGCCAGTGTGCATGTGGAATTGGACAGCTTTCAGAGGTCTGGTCTGTTCTTTTCTCTCTGTAGGCCCTAAGAAGGAAC

TCAGGCTGCTTTTGAAACAGGCGCCTTACCCTGCTGGGCAGTCTTGCTGTCCCTGCCTCATGCCATTTACTCATTGGAGAAGGAGATGCTAGAAAATTGC

AAAATTGAATACAGTGGATTTGCACACACCTGGGAGGGTTAAGAACTCATTCCAACCAATAAAAAAAAATTCAGCATTAAAAATAATGTAAGTTGTATGT

TGTCTCAAATAAGGTGAAAGGGAATTCTCTCCTGTGTGTTGTAAAAGCAAGAAAACTGAGCACTCCAAATAAATGCTTCCCTTTGAAAGTCTGATTTTGT

GGAATTTGTGCATTTTGCCTATCATTTCTGCTGTTTGGAAAAACCAAGGTTAGAAAATCCTATCTCAATGACAGTAGCAGCAGTATACACTACATGTATT

GAAGTCATGTTTTTTAGTTTGATAAATCAATTTTTTGTACTGAAATAAGTTCTCACAATGTAGACTAGGCTGGATGATATTAAAGGTGTGTGCTACTGA
Translation
MFSWLIYIYKFSQKQNQSCRSSSLLQVLCLWPR RTLVAERSCDYGDVSQCGETRQRIPECIIRRDTPPEISVCKNSVLARDILVHSLSEVHLRCETAEK

PCGSQEYVKCCKESTSSESFQTKQSPPRETPYQNKQSNEAYRSLNSDRYCEQIHTGDKLREWKQVEKAFWRYSYGQIYERITIGEEPFVCKQYGEALVNS

SHLIKHEVISPEEKCYTCKQCGKAFRYSSSLQNHERIHSGERPYVCKQCGKTFIRSYDLLIHERIHSGEKPYTCEHCGKSFTHYSGWYSHERIHTREKPY

VCTQCGKAFSCSTSFRRHERIHTGEKPYSCKHCGKAFTHSSARYIHERIHTGEKPYVCKHCGKAFLRASHLNNHERIHTGEKPYICKHCGKAFIQRDACY

NHERIHTGEKPYVCKECGKAFRISTSLRDHERIHTGEKPYICNYCGKAFRVSTCLHKHERAHAEKKPSG
Transcript ENSMUST00000087664
Sequence
ATGCAGTTGAAAAGAAGTTTA GAGCCTGTGACCTTTGAGGATGTGGCTGTGAACTTCAGCCTAGGAGAGTGGGCTCTGCTGGATTCCAGTCAAAAGAAG

CTCTACAGAGATGTGATGACGGAGACCTTTATGAATCTGATCTCCATAG - UNI12607 - GGAAAACAGAGGAAAAAGAAAATATTGAAGACAACTA

CCAAAATCTCAGGAAAAAT TTTTGCAGAACTCTGGTGGCTGAGAGGAGTTGTGACTACGGAGATGTCAGTCAGTGTGGAGAAACCCGGCAACGGATTCC

AGAGTGTATCATTCGTAGAGACACGCCTCCTGAAATATCAGTGTGTAAAAACAGTGTGCTTGCTAGAGACATCCTTGTTCATTCCCTCTCAGAAGTGCAC

CTCAGATGTGAAACTGCAGAGAAACCCTGTGGGTCTCAGGAATATGTGAAGTGTTGCAAAGAGTCTACTTCTTCTGAGTCCTTTCAGACAAAGCAAAGTC

CTCCTCGAGAGACACCCTATCAAAATAAGCAATCTAATGAAGCCTATAGGAGTCTTAATTCTGACCGGTATTGTGAGCAAATTCACACTGGAGATAAACT

CCGTGAATGGAAGCAAGTTGAGAAAGCCTTCTGGAGGTACAGTTACGGTCAAATATATGAGAGAATCACCATTGGAGAGGAACCATTTGTGTGTAAGCAG

TATGGTGAAGCCTTGGTTAATTCTAGTCATCTTATTAAACATGAAGTAATTAGCCCTGAAGAAAAATGTTACACATGTAAGCAGTGTGGGAAGGCATTCA

GATATTCCTCATCCCTTCAGAACCATGAAAGAATCCATAGCGGGGAGAGGCCATATGTATGTAAGCAATGTGGAAAAACCTTCATTCGTTCCTATGACCT

TCTTATCCATGAAAGAATTCACAGTGGAGAAAAACCTTACACGTGTGAGCATTGTGGAAAATCTTTCACCCATTATAGCGGCTGGTACAGTCATGAAAGG

ATTCACACTAGAGAGAAACCCTATGTGTGCACACAGTGTGGGAAAGCCTTTTCATGCTCTACATCGTTCCGGAGGCATGAAAGAATTCACACTGGAGAGA

AACCTTACTCCTGTAAGCACTGTGGGAAAGCCTTCACCCATTCCAGTGCTCGTTACATTCATGAGCGAATTCACACCGGAGAGAAACCCTACGTTTGTAA

GCACTGTGGAAAAGCATTCCTCCGTGCCAGTCATCTCAACAACCATGAGAGAATTCACACTGGAGAGAAACCCTATATTTGTAAGCATTGTGGGAAAGCC

TTCATCCAGCGCGATGCTTGTTATAATCACGAAAGAATTCACACTGGAGAGAAACCATATGTATGTAAGGAATGTGGAAAAGCATTTAGGATTTCCACAT

CCCTTCGTGACCATGAGAGAATTCACACTGGAGAAAAACCTTACATATGTAATTATTGTGGGAAAGCATTTAGGGTCTCCACATGCCTTCACAAACATGA

ACGAGCTCATGCTGAAAAGAAACCCA TTATTTGTAGTTAT TGTGGGGAAGCATTCAGGTGCTGCAGTTACATTCATATTCGTGAAA ACACACACACT

GGAGAAAAGGTCTACATTTGTAAG
Translation
MQLKRSL EPVTFEDVAVNFSLGEWALLDSSQKKLYRDVMTETFMNLISIG - UNI12607 - GKTEEKENIEDNYQNLRKN FCRTLVAERSCDYGD

VSQCGETRQRIPECIIRRDTPPEISVCKNSVLARDILVHSLSEVHLRCETAEKPCGSQEYVKCCKESTSSESFQTKQSPPRETPYQNKQSNEAYRSLNSD

RYCEQIHTGDKLREWKQVEKAFWRYSYGQIYERITIGEEPFVCKQYGEALVNSSHLIKHEVISPEEKCYTCKQCGKAFRYSSSLQNHERIHSGERPYVCK

QCGKTFIRSYDLLIHERIHSGEKPYTCEHCGKSFTHYSGWYSHERIHTREKPYVCTQCGKAFSCSTSFRRHERIHTGEKPYSCKHCGKAFTHSSARYIHE

RIHTGEKPYVCKHCGKAFLRASHLNNHERIHTGEKPYICKHCGKAFIQRDACYNHERIHTGEKPYVCKECGKAFRISTSLRDHERIHTGEKPYICNYCGK

AFRVSTCLHKHERAHAEKKPI IICSY CGEAFRCCSYIHIREN NTHTGEKVYICK
Transcript ENSMUST00000087666
Sequence
ATGCATCAAAAGCAGAGAATG GAGCCTGTGACCTTTGAGGATGTGGCTGTGAACTTCAGCCTAGGAGAGTGGGCTCTGCTGGATTCCAGTCAAAAGAAG

CTCTACAGAGATGTGATGACGGAGACCTTTATGAATCTGATCTCCATAG - UNI12607 - GGAAAACAGAGGAAAAAGAAAATATTGAAGACAACTA

CCAAAATCTCAGGAAAAATGTGAG AACTCTGGTGGCTGAGAGGAGTTGTGACTACGGAGATGTCAGTCAGTGTGGAGAAACCCGGCAACGGATTCCAGA

GTGTATCATTCGTAGAGACACGCCTCCTGAAATATCAGTGTGTAAAAACAGTGTGCTTGCTAGAGACATCCTTGTTCATTCCCTCTCAGAAGTGCACCTC

AGATGTGAAACTGCAGAGAAACCCTGTGGGTCTCAGGAATATGTGAAGTGTTGCAAAGAGTCTACTTCTTCTGAGTCCTTTCAGACAAAGCAAAGTCCTC

CTCGAGAGACACCCTATCAAAATAAGCAATCTAATGAAGCCTATAGGAGTCTTAATTCTGACCGGTATTGTGAGCAAATTCACACTGGAGATAAACTCCG

TGAATGGAAGCAAGTTGAGAAAGCCTTCTGGAGGTACAGTTACGGTCAAATATATGAGAGAATCACCATTGGAGAGGAACCATTTGTGTGTAAGCAGTAT

GGTGAAGCCTTGGTTAATTCTAGTCATCTTATTAAACATGAAGTAATTAGCCCTGAAGAAAAATGTTACACATGTAAGCAGTGTGGGAAGGCATTCAGAT

ATTCCTCATCCCTTCAGAACCATGAAAGAATCCATAGCGGGGAGAGGCCATATGTATGTAAGCAATGTGGAAAAACCTTCATTCGTTCCTATGACCTTCT

TATCCATGAAAGAATTCACAGTGGAGAAAAACCTTACACGTGTGAGCATTGTGGAAAATCTTTCACCCATTATAGCGGCTGGTACAGTCATGAAAGGATT

CACACTAGAGAGAAACCCTATGTGTGCACACAGTGTGGGAAAGCCTTTTCATGCTCTACATCGTTCCGGAGGCATGAAAGAATTCACACTGGAGAGAAAC

CTTACTCCTGTAAGCACTGTGGGAAAGCCTTCACCCATTCCAGTGCTCGTTACATTCATGAGCGAATTCACACCGGAGAGAAACCCTACGTTTGTAAGCA

CTGTGGAAAAGCATTCCTCCGTGCCAGTCATCTCAACAACCATGAGAGAATTCACACTGGAGAGAAACCCTATATTTGTAAGCATTGTGGGAAAGCCTTC

ATCCAGCGCGATGCTTGTTATAATCACGAAAGAATTCACACTGGAGAGAAACCATATGTATGTAAGGAATGTGGAAAAGCATTTAGGATTTCCACATCCC

TTCGTGACCATGAGAGAATTCACACTGGAGAAAAACCTTACATATGTAATTATTGTGGGAAAGCATTTAGGGTCTCCACATGCCTTCACAAACATGAACG

AGCTCATGCTGAAAAGAAACCCAGTGGGTAGAACTGAAGCCCATATAGATCTTTGATCAACTGTCAGGAAAAGTGTATGCAGGGTCAGTCAGATGGCTCA

GGGATAAAAGCACTTGCCCTAAGCTTGGTAGCCATAGTTGGAACCTCAGAACCCATGTGAAGAGAGAGAACTGAATTTCCAAGGTTTGCCTCTGACTTGT

ACATATGTGCTGTCATTTGCATGCATACCCTCACATAGATGTATAAAGAAATAGGATAATTTAAAATACCTTTTTAAATTTTGTTTTGTTTTGAGACAGG

GTTTCACTGTGCAGCCCCTTGGTTGTCCTGCAACTCACTCTGCAGACCAGGCTGGCCTTAAACTCAGAGGTCCCCCTGCCTCTGCCTTCCGAGTGTTGAG

ATTAAAAGTGTGCACGTCCCTGCTGCCTAGCTTTAAGATCATTTTAATGTTGCTTTTGATTTGTAGTTATTTGTAGTTATGTGTGGGTATGTGCATGTGA

GGGCTGGAGCACACAGCAGTCAGAGGCATCACATTCCCCAGGAGCTGGAGTTACAGGAGCCGGTGAGGTGTCCCATGTGACGGCTGGAAATCCAGCTTGG

GTCCTCCGGAGAGCAGTATATTCTGAGCCATCTTTCTAGTCTCATAGGTGTAATTAAAGACAAATTGGGAAAGAAATAGCTGGAATAGACCTTAAGATGT

GTAAATTTGGACACATATGAAATGTGATGTTGGATAAAAACGAGTTCCATCAAATGTGCTAAGGCACTTTTTTTTGGAAATTATATTTAATATAAATTAT

GAACACAGTTCATGAACATTACATAGGTGTGTGTGCATGGTGTCCACATGCCAGTGTGCATGTGGAATTGGACAGCTTTCAGAGGTCTGGTCTGTTCTTT

TCTCTCTGTAGGCCCTAAGAAGGAACTCAGGCTGCTTTTGAAACAGGCGCCTTACCCTGCTGGGCAGTCTTGCTGTCCCTGCCTCATGCCATTTACTCAT

TGGAGAAGGAGATGCTAGAAAATTGCAAAATTGAATACAGTGGATTTGCACACACCTGGGAGGGTTAAGAACTCATTCCAACCAATAAAAAAAAATTCAG

CATTAAAAATAATGTAAGTTGTATGTTGTCTCAAATAAGGTGAAAGGGAATTCTCTCCTGTGTGTTGTAAAAGCAAGAAAACTGAGCACTCCAAATAAAT

GCTTCCCTTTGAAAGTCTGATTTTGTGGAATTTGTGCATTTTGCCTATCATTTCTGCTGTTTGGAAAAACCAAGGTTAGAAAATCCTATCTCAATGACAG

TAGCAGCAGTATACACTACATGTATTGAAGTCATGTTTTTTAGTTTGATAAATCAATTTTTTGTACTGAAATAAGTTCTCACAATGTAGACTAGGCTGGA

TGATATTAAAGGTGTGTGCTACTGA
Translation
MHQKQRM EPVTFEDVAVNFSLGEWALLDSSQKKLYRDVMTETFMNLISIG - UNI12607 - GKTEEKENIEDNYQNLRKNVR RTLVAERSCDYGD

VSQCGETRQRIPECIIRRDTPPEISVCKNSVLARDILVHSLSEVHLRCETAEKPCGSQEYVKCCKESTSSESFQTKQSPPRETPYQNKQSNEAYRSLNSD

RYCEQIHTGDKLREWKQVEKAFWRYSYGQIYERITIGEEPFVCKQYGEALVNSSHLIKHEVISPEEKCYTCKQCGKAFRYSSSLQNHERIHSGERPYVCK

QCGKTFIRSYDLLIHERIHSGEKPYTCEHCGKSFTHYSGWYSHERIHTREKPYVCTQCGKAFSCSTSFRRHERIHTGEKPYSCKHCGKAFTHSSARYIHE

RIHTGEKPYVCKHCGKAFLRASHLNNHERIHTGEKPYICKHCGKAFIQRDACYNHERIHTGEKPYVCKECGKAFRISTSLRDHERIHTGEKPYICNYCGK

AFRVSTCLHKHERAHAEKKPSG

For any suggestions or comments, please send an email to unitrap@crg.es