Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053519 (Kcnip1)
Chromosomal location
Chr 11: 33529339 - 33892836 (-)
Description
Kv channel-interacting protein 1 Gene [Source:MGI (curated);Acc:Kcnip1-002]
RefSeq_dna
NM_027398 
RefSeq_peptide
NP_081674.2 
UniGene
Mm.252514 
MGI
MGI:1917607 
Uniprot/SWISSPROT
Q9JJ57 
Uniprot/SPTREMBL
Q3YAB4 Q3YAB6 Q3YAB5 
Human Ortholog
ENSG00000182132 (KCNIP1)
Omim not available
UniTrap UNI32545
Vector Insertion
Chr 11: 33743129 - 33892837
Public Clones IST11057G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101368
Sequence
CGCACCGGGGGGCGCCTGTGAAGGCTCCCGCGAGCCTCTGGCCCTGGGAGTCAGTGCATGTGCCTGGCTGAAGAAGGCAGCAGCCACGAGCTCCAGGCGC

CCCGGCCCCACGTTTTCTGAATACCAAGCTGCAGGCGAGCTGCTCGGGGCTTTTTTGCTTTCTCGCTTTTCCTCTCCTCCAATTCAAAGTGGGCAATCCA

CACCGATTTCTTTTCAGGGGAGGGAAGAGACAGGGCCTGGGGTCCCAAGACGCACACAAGTCTTCGCTGCCATGGGGGCCGTCATGGGCACTTTCTCCTC

CCTGCAGACCAAACAAAGGCGACCCTCTAAAG - UNI32545 - AGCAACACAGTGGACAGATTGTGAAGCAGGCTGAGTGGGCAGGGGAGTGGGGCT

CAAGGCCCAGGACCACCTGCAGTGCGACCCAGCCCAAGCCCAAAGCCCTAGTTCCCCACACTCTCTGAACAGCTCAGACTGGTCCGACAGAGACGGAGGC

GGTCACGTTCTGACACCGTCCCCTCTGCTTCCAGACAAGATTGAGGATGAGCTAGAGATGACCATGGTTTGCCACCGGCCTGAGGGACTGGAGCAGCTTG

AGGCACAGACGAACTTCACCAAGAGAGAACTGCAAGTCTTGTACCGGGGATTCAAAAAC GAGTGCCCTAGCGGTGTGGTCAATGAAGAAACATTCAAGC

AGATCTACGCTCAGTTTTTCCCTCACGGAG ATGCCAGCACATATGCACATTACCTCTTCAATGCCTTCGACACCACCCAGACAGGCTCTGTAAAGTTCG

AG GACTTTGTGACTGCTCTGTCGATTTTACTGAGAGGGACAGTCCATGAAAAACTAAGGTGGACGTTTAATTTGTATGACATCAATAAAGACGGCTACA

TAAACAAAGAG GAGATGATGGACATAGTCAAAGCCATCTATGACATGATGGGGAAATACACCTATCCTGTGCTCAAAGAGGACACTCCCAGGCAGCATG

TGGATGTCTTCTTCCAG AAAATGGATAAAAATAAAGATGGCATTGTAACGTTAGATGAATTTCTTGAATCATGTCAGGAG GATGACAACATCATGAGA

TCTCTACAGCTGTTCCAAAATGTCATGTAACTGAGGACACTGGCCATTCTGCTCTCAGAGACACTGACAAACACCTTAATGCCCTGATCTGCCCTTGTTC

CAATTTTACACACCAACTCTTGGGACAGAAATACCTTTTACACTTTGGAAGAATTCTCTGCTGAAGACTTTCTACAAAACCTGGCACCACGTGGCTCTGT

CTCTGAGGGACGAGCGGAGATCCGACTTTGTTTTGGAAGCATGCCCATCTCTTCATGCTGCTGCCCTGTGGAAGGCCCCTCTGCTTGAGCTTAATCAATA

GTGCACAGTTTTATGCTTACACATATCCCCAACTCACTGCCTCCAAGTCAGGCAGACTCTGATGAATCTGAGCCAAATGTGCACCATCCTCCGATGGCCT

CCCAAGCCAATGTGCCTGCTTCTCTTCCTCTGGTGGGAAGAAAGAGTGTTCTACGGAACAATTAGAGCTTACCATGAAAATATTGGGAGAGGCAGCACCT

AACACATGTAGAATAGGACTGAATTATTAAGCATGGTGATATCAGATGATGCAAATTGCCCATGTCATTTTTTTCAAAGGTAGGGACAAATGATTCTCCC

ACACTAGCACCTGTGGTCATAGAGCAAGTCTCTTAACATGCCCAGAAGGGGAACCACTGTCCAGTGGTCTATCCCTCCTCTCCATCCCCTGCTCAAACCC

AGCACTGCATGTCCCTCCAAGAAGGTCCAGAATGCCTGCGAAACGCTGTACTTTTATACCCTGTTCTAATCAATAAACAGAACTATTTCGTACACTCTCA

ATTACTTCTTCTATGACTCTATGGCTCAGGAGAGGCAAGTTGTGACAAAGGGTGGTTAGTCCACCCATTTGGCCTCTGGTTACTAGTACTTTCTTGGGGC

CACATGCTTTCACCCTTAAACCATCTTCATTAGCATGCAATTCAAATACTGTGATCATGTGCAAATGGTACTTCCAGACAGCACCTCTTTTCTAATAGGA

TTGCTCCTCCCAAGACTCCAATATAAAAAAATACCAGAGCCTCATATGGCACAACTAGAGCTGAAAAGGACCAGTCCTCTCTGATGATGATGTAGAGTCC

AAAGACTGATCAAGTAGTTCCATCTTATAACCATAAAATGATTACGTGGGTCCAATGTCATGTATCTTAGTTTTCCGTGTGTTATCACATTAAATATTTC

CTTACACATTAAAAAATGCTCTAACAAGAGCTTCCTTGAAAA
Translation
 - UNI32545 - MTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKN ECPSGVVNEETFKQIYAQFFPHGD DASTYAHYLFNAFDTTQTGSVKFE D

FVTALSILLRGTVHEKLRWTFNLYDINKDGYINKE EMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQ KMDKNKDGIVTLDEFLESCQE DDNIMR

SLQLFQNVM
Transcript ENSMUST00000065970
Sequence
ACCGCACGCGGCGCGGGCTCGGCAGCCTCGGCCGTGCGGGCACGCCGGCCCCGTGTCCAACATCAGGCAGGCTTTGGGGCTCGGGGCTCGGGCCTCGGAG

AAGCCAGTGGCCCGGCTGGGTGCCCGCACCGGGGGGCGCCTGTGAAGGCTCCCGCGAGCCTCTGGCCCTGGGAGTCAGTGCATGTGCCTGGCTGAAGAAG

GCAGCAGCCACGAGCTCCAGGCGCCCCGGCCCCACGTTTTCTGAATACCAAGCTGCAGGCGAGCTGCTCGGGGCTTTTTTGCTTTCTCGCTTTTCCTCTC

CTCCAATTCAAAGTGGGCAATCCACACCGATTTCTTTTCAGGGGAGGGAAGAGACAGGGCCTGGGGTCCCAAGACGCACACAAGTCTTCGCTGCCATGGG

GGCCGTCATGGGCACTTTCTCCTCCCTGCAGACCAAACAAAGGCGACCCTCTAAAG - UNI32545 - ACATCGCCTGGTGGTATTACCAGTATCAGA

GAG ACAAGATTGAGGATGAGCTAGAGATGACCATGGTTTGCCACCGGCCTGAGGGACTGGAGCAGCTTGAGGCACAGACGAACTTCACCAAGAGAGAAC

TGCAAGTCTTGTACCGGGGATTCAAAAAC GAGTGCCCTAGCGGTGTGGTCAATGAAGAAACATTCAAGCAGATCTACGCTCAGTTTTTCCCTCACGGAG

 ATGCCAGCACATATGCACATTACCTCTTCAATGCCTTCGACACCACCCAGACAGGCTCTGTAAAGTTCGAG GACTTTGTGACTGCTCTGTCGATTTTA

CTGAGAGGGACAGTCCATGAAAAACTAAGGTGGACGTTTAATTTGTATGACATCAATAAAGACGGCTACATAAACAAAGAG GAGATGATGGACATAGTC

AAAGCCATCTATGACATGATGGGGAAATACACCTATCCTGTGCTCAAAGAGGACACTCCCAGGCAGCATGTGGATGTCTTCTTCCAG AAAATGGATAAA

AATAAAGATGGCATTGTAACGTTAGATGAATTTCTTGAATCATGTCAGGAG GATGACAACATCATGAGATCTCTACAGCTGTTCCAAAATGTCATGTAA

CTGAGGACACTGGCCATTCTGCTCTCAGAGACACTGACAAACACCTTAATGCCCTGATCTGCCCTTGTTCCAATTTTACACACCAACTCTTGGGACAGAA

ATACCTTTTACACTTTGGAAGAATTCTCTGCTGAAGACTTTCTACAAAACCTGGCACCACGTGGCTCTGTCTCTGAGGGACGAGCGGAGATCCGACTTTG

TTTTGGAAGCATGCCCATCTCTTCATGCTGCTGCCCTGTGGAAGGCCCCTCTGCTTGAGCTTAATCAATAGTGCACAGTTTTATGCTTACACATATCCCC

AACTCACTGCCTCCAAGTCAGGCAGACTCTGATGAATCTGAGCCAAATGTGCACCATCCTCCGATGGCCTCCCAAGCCAATGTGCCTGCTTCTCTTCCTC

TGGTGGGAAGAAAGAGTGTTCTACGGAACAATTAGAGCTTACCATGAAAATATTGGGAGAGGCAGCACCTAACACATGTAGAATAGGACTGAATTATTAA

GCATGGTGATATCAGATGATGCAAATTGCCCATGTCATTTTTTTCAAAGGTAGGGACAAATGATTCTCCCACACTAGCACCTGTGGTCATAGAGCAAGTC

TCTTAACATGCCCAGAAGGGGAACCACTGTCCAGTGGTCTATCCCTCCTCTCCATCCCCTGCTCAAACCCAGCACTGCATGTCCCTCCAAGAAGGTCCAG

AATGCCTGCGAAACGCTGTACTTTTATACCCTGTTCTAATCAATAAACAGAACTATTTCGT
Translation
MGAVMGTFSSLQTKQRRPSKD - UNI32545 - DIAWWYYQYQRD DKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKN ECPSGVVNE

ETFKQIYAQFFPHGD DASTYAHYLFNAFDTTQTGSVKFE DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKE EMMDIVKAIYDMMGKYTYPVLK

EDTPRQHVDVFFQ KMDKNKDGIVTLDEFLESCQE DDNIMRSLQLFQNVM
Transcript ENSMUST00000109340
Sequence
ACCGCACGCGGCGCGGGCTCGGCAGCCTCGGCCGTGCGGGCACGCCGGCCCCGTGTCCAACATCAGGCAGGCTTTGGGGCTCGGGGCTCGGGCCTCGGAG

AAGCCAGTGGCCCGGCTGGGTGCCCGCACCGGGGGGCGCCTGTGAAGGCTCCCGCGAGCCTCTGGCCCTGGGAGTCAGTGCATGTGCCTGGCTGAAGAAG

GCAGCAGCCACGAGCTCCAGGCGCCCCGGCCCCACGTTTTCTGAATACCAAGCTGCAGGCGAGCTGCTCGGGGCTTTTTTGCTTTCTCGCTTTTCCTCTC

CTCCAATTCAAAGTGGGCAATCCACACCGATTTCTTTTCAGGGGAGGGAAGAGACAGGGCCTGGGGTCCCAAGACGCACACAAGTCTTCGCTGCCATGGG

GGCCGTCATGGGCACTTTCTCCTCCCTGCAGACCAAACAAAGGCGACCCTCTAAAG - UNI32545 - ACAAGATTGAGGATGAGCTAGAGATGACCA

TGGTTTGCCACCGGCCTGAGGGACTGGAGCAGCTTGAGGCACAGACGAACTTCACCAAGAGAGAACTGCAAGTCTTGTACCGGGGATTCAAAAAC GAGT

GCCCTAGCGGTGTGGTCAATGAAGAAACATTCAAGCAGATCTACGCTCAGTTTTTCCCTCACGGAG ATGCCAGCACATATGCACATTACCTCTTCAATG

CCTTCGACACCACCCAGACAGGCTCTGTAAAGTTCGAG GACTTTGTGACTGCTCTGTCGATTTTACTGAGAGGGACAGTCCATGAAAAACTAAGGTGGA

CGTTTAATTTGTATGACATCAATAAAGACGGCTACATAAACAAAGAG GAGATGATGGACATAGTCAAAGCCATCTATGACATGATGGGGAAATACACCT

ATCCTGTGCTCAAAGAGGACACTCCCAGGCAGCATGTGGATGTCTTCTTCCAG AAAATGGATAAAAATAAAGATGGCATTGTAACGTTAGATGAATTTC

TTGAATCATGTCAGGAG GATGACAACATCATGAGATCTCTACAGCTGTTCCAAAATGTCATGTAACTGAGGACACTGGCCATTCTGCTCTCAGAGACAC

TGACAAACACCTTAATGCCCTGATCTGCCCTTGTTCCAATTTTACACACCAACTCTTGGGACAGAAATACCTTTTACACTTTGGAAGAATTCTCTGCTGA

AGACTTTCTACAAAACCTGGCACCACGTGGCTCTGTCTCTGAGGGACGAGCGGAGATCCGACTTTGTTTTGGAAGCATGCCCATCTCTTCATGCTGCTGC

CCTGTGGAAGGCCCCTCTGCTTGAGCTTAATCAATAGTGCACAGTTTTATGCTTACACATATCCCCAACTCACTGCCTCCAAGTCAGGCAGACTCTGATG

AATCTGAGCCAAATGTGCACCATCCTCCGATGGCCTCCCAAGCCAATGTGCCTGCTTCTCTTCCTCTGGTGGGAAGAAAGAGTGTTCTACGGAACAATTA

GAGCTTACCATGAAAATATTGGGAGAGGCAGCACCTAACACATGTAGAATAGGACTGAATTATTAAGCATGGTGATATCAGATGATGCAAATTGCCCATG

TCATTTTTTTCAAAGGTAGGGACAAATGATTCTCCCACACTAGCACCTGTGGTCATAGAGCAAGTCTCTTAACATGCCCAGAAGGGGAACCACTGTCCAG

TGGTCTATCCCTCCTCTCCATCCCCTGCTCAAACCCAGCACTGCATGTCCCTCCAAGAAGGTCCAGAATGCCTGCGAAACGCTGTACTTTTATACCCTGT

TCTAATCAATAAACAGAACTATTTCGT
Translation
MGAVMGTFSSLQTKQRRPSKD - UNI32545 - DKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKN ECPSGVVNEETFKQIYAQFFPH

GD DASTYAHYLFNAFDTTQTGSVKFE DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKE EMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQ

 KMDKNKDGIVTLDEFLESCQE DDNIMRSLQLFQNVM
Transcript ENSMUST00000093194
Sequence
ATGAGCAGCTGCTCCAAAAGATGCAGACTCGGGTTCGTGAAATTTGCCCAGACCATCTTTAAACTCATCACCGGGACCCTCAGCAAAG - UNI32545 

- ACAAGATTGAGGATGAGCTAGAGATGACCATGGTTTGCCACCGGCCTGAGGGACTGGAGCAGCTTGAGGCACAGACGAACTTCACCAAGAGAGAACTG

CAAGTCTTGTACCGGGGATTCAAAAAC GAGTGCCCTAGCGGTGTGGTCAATGAAGAAACATTCAAGCAGATCTACGCTCAGTTTTTCCCTCACGGAG A

TGCCAGCACATATGCACATTACCTCTTCAATGCCTTCGACACCACCCAGACAGGCTCTGTAAAGTTCGAG GACTTTGTGACTGCTCTGTCGATTTTACT

GAGAGGGACAGTCCATGAAAAACTAAGGTGGACGTTTAATTTGTATGACATCAATAAAGACGGCTACATAAACAAAGAG GAGATGATGGACATAGTCAA

AGCCATCTATGACATGATGGGGAAATACACCTATCCTGTGCTCAAAGAGGACACTCCCAGGCAGCATGTGGATGTCTTCTTCCAG AAAATGGATAAAAA

TAAAGATGGCATTGTAACGTTAGATGAATTTCTTGAATCATGTCAGGAG GATGACAACATCATGAGATCTCTACAGCTGTTCCAAAATGTCATGTAA
Translation
MSSCSKRCRLGFVKFAQTIFKLITGTLSKD - UNI32545 - DKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKN ECPSGVVNEETFK

QIYAQFFPHGD DASTYAHYLFNAFDTTQTGSVKFE DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKE EMMDIVKAIYDMMGKYTYPVLKEDTP

RQHVDVFFQ KMDKNKDGIVTLDEFLESCQE DDNIMRSLQLFQNVM
Transcript ENSMUST00000109341
Sequence
ATGAGCAGCTGCTCCAAAAGATGCAGACTCGGGTTCGTGAAATTTGCCCAGACCATCTTTAAACTCATCACCGGGACCCTCAGCAAAG - UNI32545 

- ACATCGCCTGGTGGTATTACCAGTATCAGAGAG ACAAGATTGAGGATGAGCTAGAGATGACCATGGTTTGCCACCGGCCTGAGGGACTGGAGCAGCT

TGAGGCACAGACGAACTTCACCAAGAGAGAACTGCAAGTCTTGTACCGGGGATTCAAAAAC GAGTGCCCTAGCGGTGTGGTCAATGAAGAAACATTCAA

GCAGATCTACGCTCAGTTTTTCCCTCACGGAG ATGCCAGCACATATGCACATTACCTCTTCAATGCCTTCGACACCACCCAGACAGGCTCTGTAAAGTT

CGAG GACTTTGTGACTGCTCTGTCGATTTTACTGAGAGGGACAGTCCATGAAAAACTAAGGTGGACGTTTAATTTGTATGACATCAATAAAGACGGCTA

CATAAACAAAGAG GAGATGATGGACATAGTCAAAGCCATCTATGACATGATGGGGAAATACACCTATCCTGTGCTCAAAGAGGACACTCCCAGGCAGCA

TGTGGATGTCTTCTTCCAG AAAATGGATAAAAATAAAGATGGCATTGTAACGTTAGATGAATTTCTTGAATCATGTCAGGAG GATGACAACATCATGA

GATCTCTACAGCTGTTCCAAAATGTCATGTAA
Translation
MSSCSKRCRLGFVKFAQTIFKLITGTLSKD - UNI32545 - DIAWWYYQYQRD DKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKN 

ECPSGVVNEETFKQIYAQFFPHGD DASTYAHYLFNAFDTTQTGSVKFE DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKE EMMDIVKAIYDMM

GKYTYPVLKEDTPRQHVDVFFQ KMDKNKDGIVTLDEFLESCQE DDNIMRSLQLFQNVM

For any suggestions or comments, please send an email to unitrap@crg.es