Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053550 (D430041B17Rik)
Chromosomal location
Chr 7: 4777154 - 4787857 (-)
Description
RIKEN cDNA D430041B17 gene Gene [Source:MGI Symbol;Acc:MGI:3605641]
RefSeq_dna
NM_172737 
RefSeq_peptide
NP_766325.2 
UniGene
Mm.44666 
MGI
MGI:3605641 
Uniprot/SWISSPROT
Q8C3Q5 
Human Ortholog
ENSG00000187902 (AC135592.2)
Omim not available
UniTrap UNI35890
Vector Insertion
Chr 7: 4785831 - 4787777
Public Clones IST12581A8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30653
Vector Insertion
Chr 7: 4777153 - 4781878
Public Clones IST10573H1 (tigm) IST12260A9 (tigm) IST12260B10BBF1 (tigm) IST12042D8 (tigm)
IST10222A9 (tigm) IST13409A6 (tigm) IST10516C5 (tigm) IST13244G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119433
Sequence
GGTGGGGGACCAGGGCCGGGCCAGGCAGGGTGGCTGGAAGGGGGCCGGGCCGGGGGCGCTGGGGGACGTGGGGGAGAGGGCCCAGGGGGCAGCACAGCCT

ACGTGGTGTGCGGAGTCATCAGTTTCGCCCTGGCGGTGGGCGTCGGTGCCAAAGTGGCCTTCAGCAAGGCGTCACGTGCACCCAGGGCGCACCGGGAGAT

CAACGTGCCCAG - UNI35890 - AGCTCTCGTGGATATTCTCAGGCATCAAGCAGGACCTGCAACCCGCCCGGACCGGGCCAGAAGCAGTTCTCTGA

CCCCAGGGCTGGGAGGCCCAGACAGCATGGCCCCAAGGACACCCAAGAACCTTTACAACACCATGAAGCCCTCCAACCTCG - UNI35890 - ACTGG

CGTGCTATGCCGCCGCCCAGCCCCTCCCTGCACTACTCCACACTATCCTGCTCCCGATCCTTCCACAACCTCTCTCATCTTCCCCCGTCCTATGAGGCTG

CTGTGAAATCAGAACTGAATCGATACTCTTCCCTCAAGAGACTGG - UNI30653 - CTGAGAAAGATCTGGATGAAGCCTACCTGAAGCGCAGACAA

CTGGAGATGCCGCGCGGAACGCTGCCCTTGCATGCACTCCGGCGGCCTGGCACTGGAGGTGGCTACCGTATGGATGGCTGGGGTGGCCCTGAGGAGCTGG

GCCTGGCACCAGCACCCAACCCACGGCGTGTTATGTCCCAGGAGCACCTTCTGGGTGATGGTAGCCGAGCTTCCCGCTATGAGTTCACGTTGCCTCGAGC

GCGCCTGGTGTCTCAGGAACACCTGCTGCTGTCCTCACCTGAGGCGCTTCGCCAGAGTCGCGAGCACCTGCTGTCACCCCCACGAAGTCCTGCACTGCCC

CCAGATCCCACCACCCGGGCCAGCCTGGCTGCCTCACACTCCAACCTGCTGCTAGGGCCTGGGGGCCCCCCCACACCCCTGCATGGGTTGCCTCCGTCAG

GCCTGCATGCCCACCATCACCATGCCCTTCATGGCTCTCCTCAGCCAGCCTGGATGTCTGATGCGGGCGGGGGTGGGGGCACACTGGCCCGCAGGCCACC

CTTCCAGCGCCAGGGCACCCTGGAGCAGCTGCAGTTCATTCCTGGGCACCACCTGCCCCAGCACCTGCGCACTGCCAGCAAGAACGAAGTGACTGTCTGA

GGCCCGGTGGAGTGCTGGGGGCTGTGGCTTCCGAGGCCCCCTTCTCCCAGCCCAGATCTCCATTACAAGGCTTATCATACACACCAAGGCTCTGAGACCA

GATGGGCCCTTGGACCGGAGACCACGCCTCCTTTTGGGATGTTACAGTAGATGAGATCTCTCCTTTTACTTTGTCACTGTTTGAACCAAGGCCTCCCTCC

CATGATGTCATCCCAGAGGAAGGAGGCCTGTATATGAGGTCATTGCTAGCAAATATGTCTGTGTTTTATGATGTTGTTTGCAGGGACTAAACCTCCTTCC

TATGAGGTCACCACAGAGGAAGAGCCCTGCCTGAGGTCATCACTAGAGGCTATGTCCATTTTGCATGACATCACCACAGAAACTCCTTTCCTGTGATGTC

ACTACGACAATGCCTTGTCCCATCCCATCATCCCTACAAACAAAAATTTCTTCCTGCGTGTCACTACAGAGACAAGTCTCACACTTCTTGACACTTGTTG

ACATCATCCTGACTGAGCACCAAGGCCTCTTGCAATTATCATCACAGGAAAAATGTTTCTCTGCCATGGAGAAGATAGCTCCATTCCATGATGCCACCAC

TACAGACAAAGCCATTTTCCTGGGACACATCGCAGTGGACTACGCCCTGCCAGTTATGTCCTCACTAACAATTAGGCCTCCTTTCCACAATACTATCACA

GGACTTTGCCTCCCTCCTGTGATGCCATCACCAGAATAGGTGCCTTGCCCAATGGCGCCATCACAGGGACTGTGCCTCTTCATGTGATGTCATTACCAGA

AATGACCACCTGTTCTTGGGACTTCTCCAGAGTGAGGCCCTTCTGTGGTGTGACCACCAGTTACCACCCACTTGGAAATGACACCAGGAGACACCTCTAT

CGCTGTGCCATGTCGTGAGAAAGTTGGGCATGTGTAGCCCAAGGCCACCTGGGAAGAGGCCAGAGAAAGTAACCTGTCCTGAGATGTCATGAGGGCGTCA

GCACTAGGGATACTAGGGTCTTTCTATAGGATGCTGGGGGTGATGCCCTCTATTGCTTGGACATCATCATAGAGTGCTTCCTTCTCAGAGGTGTTCCCCA

CTCTAGATGACCAACAGTAGTGACTGCATAATGATTGTGTCATCAGAGTCCTTAAGTCCCTATAGCTGAGCTCTGTGCTTCTTTCTTTGCGTGACCCCAG

GGGCATAGCCAACAGGATGTCTACTAGCCCCAGTAAAGGCAGACTGGGCCTGTGCAGTGAGCCCTGGGGATGCAGTGAGCCCTGGGGACGGCACCCATGG

ATGAGCTTCAGCTCCACAGCCGCTCTGATCCACAGGGCTGCTAAAGTCCTGGGACTCAAGGGTGAGCCAAAGGATGGCATCACTTCTTTCTGCCATATCT

AAAGACATCAGCTCTCAACACAGTCCCCATCTCTATTGGAGGGGAAGGGTTAGGGTATATGTGCTGTTGACCTTGCCAATGACATCATCAATGCCACCCA

GTGTCCTCCTTTCATGATGGCATAGCAGTTGGGGTCCAATGTTAACTGTGTCATTTCCCAGAATTCCATGACTCACCTCAATTACCATATCAACTTCCAG

GCATTATC
Translation
 - UNI35890 - MAPRTPKNLYNTMKPSNLD - UNI35890 - DWRAMPPPSPSLHYSTLSCSRSFHNLSHLPPSYEAAVKSELNRYSSLKRLA -

 UNI30653 - AEKDLDEAYLKRRQLEMPRGTLPLHALRRPGTGGGYRMDGWGGPEELGLAPAPNPRRVMSQEHLLGDGSRASRYEFTLPRARLVSQEH

LLLSSPEALRQSREHLLSPPRSPALPPDPTTRASLAASHSNLLLGPGGPPTPLHGLPPSGLHAHHHHALHGSPQPAWMSDAGGGGGTLARRPPFQRQGTL

EQLQFIPGHHLPQHLRTASKNEVTV
Transcript ENSMUST00000117452
Sequence
CCAGGGGGCAGCACAGCCTACGTGGTGTGCGGAGTCATCAGTTTCGCCCTGGCGGTGGGCGTCGGTGCCAAAGTGGCCTTCAGCAAGGCGTCACGTGCAC

CCAGGGCGCACCGGGAGATCAACGTGCCCAG - UNI35890 - AGCTCTCGTGGATATTCTCAGGCATCAAGCAGGACCTGCAACCCGCCCGGACCGG

GCCAGAAGCAGTTCTCTGACCCCAGGGCTGGGAGGCCCAGACAGCATGGCCCCAAGGACACCCAAGAACCTTTACAACACCATGAAGCCCTCCAACCTCG

 - UNI35890 - ATAACCTGCACTACAACGTCAACAGCCCCAAGCACCACGCCGCCACACTGG ACTGGCGTGCTATGCCGCCGCCCAGCCCCTCCCT

GCACTACTCCACACTATCCTGCTCCCGATCCTTCCACAACCTCTCTCATCTTCCCCCGTCCTATGAGGCTGCTGTGAAATCAGAACTGAATCGATACTCT

TCCCTCAAGAGACTGG - UNI30653 - CTGAGAAAGATCTGGATGAAGCCTACCTGAAGCGCAGACAACTGGAGATGCCGCGCGGAACGCTGCCCTT

GCATGCACTCCGGCGGCCTGGCACTGGAGGTGGCTACCGTATGGATGGCTGGGGTGGCCCTGAGGAGCTGGGCCTGGCACCAGCACCCAACCCACGGCGT

GTTATGTCCCAGGAGCACCTTCTGGGTGATGGTAGCCGAGCTTCCCGCTATGAGTTCACGTTGCCTCGAGCGCGCCTGGTGTCTCAGGAACACCTGCTGC

TGTCCTCACCTGAGGCGCTTCGCCAGAGTCGCGAGCACCTGCTGTCACCCCCACGAAGTCCTGCACTGCCCCCAGATCCCACCACCCGGGCCAGCCTGGC

TGCCTCACACTCCAACCTGCTGCTAGGGCCTGGGGGCCCCCCCACACCCCTGCATGGGTTGCCTCCGTCAGGCCTGCATGCCCACCATCACCATGCCCTT

CATGGCTCTCCTCAGCCAGCCTGGATGTCTGATGCGGGCGGGGGTGGGGGCACACTGGCCCGCAGGCCACCCTTCCAGCGCCAGGGCACCCTGGAGCAGC

TGCAGTTCATTCCTGGGCACCACCTGCCCCAGCACCTGCGCACTGCCAGCAAGAACGAAGTGACTGTCTGAGGCCCGGTGGAGTGCTGGGGGCTGTGGCT

TCCGAGGCCCCCTTCTCCCAGCCCAGATCTCCATTACAAGGCTTATCATACACACCAAGGCTCTGAGACCAGATGGGCCCTTGGACCGGAGACCACGCCT

CCTTTTGGGATGTTACAGTAGATGAGATCTCTCCTTTTACTTTGTCACTGTTTGAACCAAGGCCTCCCTCCCATGATGTCATCCCAGAGGAAGGAGGCCT

GTATATGAGGTCATTGCTAGCAAATATGTCTGTGTTTTATGATGTTGTTTGCAGGGACTAAACCTCCTTCCTATGAGGTCACCACAGAGGAAGAGCCCTG

CCTGAGGTCATCACTAGAGGCTATGTCCATTTTGCATGACATCACCACAGAAACTCCTTTCCTGTGATGTCACTACGACAATGCCTTGTCCCATCCCATC

ATCCCTACAAACAAAAATTTCTTCCTGCGTGTCACTACAGAGACAAGTCTCACACTTCTTGACACTTGTTGACATCATCCTGACTGAGCACCAAGGCCTC

TTGCAATTATCATCACAGGAAAAATGTTTCTCTGCCATGGAGAAGATAGCTCCATTCCATGATGCCACCACTACAGACAAAGCCATTTTCCTGGGACACA

TCGCAGTGGACTACGCCCTGCCAGTTATGTCCTCACTAACAATTAGGCCTCCTTTCCACAATACTATCACAGGACTTTGCCTCCCTCCTGTGATGCCATC

ACCAGAATAGGTGCCTTGCCCAATGGCGCCATCACAGGGACTGTGCCTCTTCATGTGATGTCATTACCAGAAATGACCACCTGTTCTTGGGACTTCTCCA

GAGTGAGGCCCTTCTGTGGTGTGACCACCAGTTACCACCCACTTGGAAATGACACCAGGAGACACCTCTATCGCTGTGCCATGTCGTGAGAAAGTTGGGC

ATGTGTAGCCCAAGGCCACCTGGGAAGAGGCCAGAGAAAGTAACCTGTCCTGAGATGTCATGAGGGCGTCAGCACTAGGGATACTAGGGTCTTTCTATAG

GATGCTGGGGGTGATGCCCTCTATTGCTTGGACATCATCATAGAGTGCTTCCTTCTCAGAGGTGTTCCCCACTCTAGATGACCAACAGTAGTGACTGCAT

AATGATTGTGTCATCAGAGTCCTTAAGTCCCTATAGCTGAGCTCTGTGCTTCTTTCTTTGCGTGACCCCAGGGGCATAGCCAACAGGATGTCTACTAGCC

CCAGTAAAGGCAGACTGGGCCTGTGCAGTGAGCCCTGGGGATGCAGTGAGCCCTGGGGACGGCACCCATGGATGAGCTTCAGCTCCACAGCCGCTCTGAT

CCACAGGGCTGCTAAAGTCCTGGGACTCAAGGGTGAGCCAAAGGATGGCATCACTTCTTTCTGCCATATCTAAAGACATCAGCTCTCAACACAGTCCCCA

TCTCTATTGGAGGGGAAGGGTTAGGGTATATGTGCTGTTGACCTTGCCAATGACATCATCAATGCCACCCAGTGTCCTCCTTTCATGATGGCATAGCAGT

TGGGGTCCAATGTTAACTGTGTCATTTCCCAGAATTCCATGACTCACCTCAATTACCATATCAACTTCCAGGCATTATCACCATTAATGGCATCATCATT

GCCTCCCAAGATCCCTCCCAACCATGGTGTCATCATTTCCCAGGGTCCAAACAACACATCATCATGATGTCCCAGGATCCACTATGTCCTCATTGCTTCC

CAGAATCCTTCACAACATGCTCACCTCATCACCTCCCAGCATCCATCACAGCCAGGGGGTCTTCATCTCCCAGCAATCACAACCATACAGTCCTCACCAT

CTCCCAGATGGTGAGATCCATCAGAACCACACTGTCCTCATCTCTCAGGACTTGTTAGGACTGATAGAGCCAGAGTCTCTCGTGACTCCATATAATTGCA

GTGTCACCTCCCAGGACCCACTTTAGCCATGTCTTCATGTCTCAGTAGCCATCATAGCTATGATGTCACCACTTCATAAAATCCACTCCAACTGTGGTGT

CCCTGGATTCTTGTGACCATGTATCATCACATCCCAGTATCCATCTAATAGTGTCACAAGTATCATATACAATGAGCATCTATGAGGACCATCATTCTGT

CACCTCCCTAGACACATCAGTCATGTCCTATCACGACTCATCAGGATTTACTGTAACTGTGGTGCCATCACCTCCAAGCAGCCATAATAGCCAACAGTGT

CTTCATTCTCCAGGACCTACTTCAACCCCAGTGTCTCCATGGCTTAGGGTCTACCATAATCACAGTTGTCATCACCTCCCTGGACCCATGGCAACAATAA

TGTTATCATTTCCAGAGTGTACTTCAGCGATGGTGCCATCATCCTCTCCCAGAATCCATGTAAAACCGTGTGTCCTCATCTTCTAGGACCCGTGGCAATT

GTGTGCCATCTACCAGGACCCATCATCTTAGGGTCCAAATGTTGTGACAGGCTATATTTCAGTTGTCCTCTGGGGTCTCATGGCATTTACAGTTCCTCCC

TTTAGGGGAACCAGCACAACAGGCCATTTCCCATTCCCTCCAATGGACTAGGGTGGAGCCAGCTGCCTCCTCTGATAATGTCACCCCACTCTGTCCCTTC

TTAATGTGTCACTGCCTCATTCCTGATCCGAATAGATACCTGGATCAGCTTCACCTACAGACTTGGCCTTGGCAAGCCTCCTTCCACTCACTGGTGAGTG

CATCTTAACTCTTCTTGGATTACCACTGTCCCTTGCCCAGCCATCTGATCGGTGACAGGGTCATCTTGGTGACCTCTCCACAGCAGCAGCAGAGGGGGAG

CTTCCCAGCCCTTAGATGGCATCACTGCCCTAACCCACTCCATTTCTGGTACTTGGTCCCAACCAGGATCAGAACTTGCTGGCTTGGGCCATGCTCTGTC

TAGAGAGGATGTAGGAGATGCCACAGCTGATAAACCACCCGCTGGCCTATTCCTGGAGTATGTATATCTGAGAGCAATGGCCCCTGCTACCTTCACCTGA

AAAGGCCAAGGGTGCTCCTTTGCCTCTTTCCCTAATATACCAGGGAGTGAGTACCCAGGGGCTTCAGGAAGTCCCTGACACCCAGTGCACAATCTTTTCC

TGCCACACCCAGTTCTCTGTACATATAGCCATGTTTCAGGGGGGCGGCCATTCCCCACTCTTAAAGGGCTACATGCCCCCCTCCCAGCCCCTATGGCAAG

GAGAGGGGCTCTTCTCCCTCCTCTGGGCCGCCCTCTCCCTCTTATGTCTCCCTCCCCCCACCAAATATTGGCCCCTGTGGCCATCCCTTCTTGCCCAGAG

CCTGGATGGGATAGATGGTAACAGGCTCTCACCATGCTGAGGAAAGTAGGGAGTTACCACCAATCTTCCTAAATGCCAGCACCAGGTTTTCGGCCTCCCA

ACTAATAGATGCTCCATGGGCTCCGCATCCATTCTAGGGCCTCCCTTCAAGTGTGCTTAACACTCCCATGGAACACACAGCTTTCTCCAAGCCCTGGAGA

GGTTCAGGGGCTTTCAGCTTTTGTTTGCCCACTCTCTCTTTCCCTTCATCCCTCCCCAAACCTGAATTCCTTCCTTCCTGGGATCTGCCCTCACCCCAGC

CTCCACCCTCCACCTGCCTGACCCTGAAGTCTTGACCTCTTATTTCAATAAAGCCATAGTGGGGAGAGGTCTTGAGGGTGGGCCAGCAGGCCCTGTTCTG

CTCATCCCCCACCATCACCACGATGCTTCCAGAATTGGGACCTGGCCTTCTGAGTCTTCCCCTCCCCACCCCCACCCCTGCTCCCCAATAAACACAAATA

CACATAGGCAGGGTGTGCCCATGCAGGAAAGCTCCCTTCTGGCTGGGGGCTGCAGAGGGGGTGTCAGAGACAAGATCAAAGTGCCACACCAGAGGTTCCT

CAGGCCTCTGAACCCCATTCTTACTCCCCTCCCCACACTTCCTTCCAGTGCTGGACTCACCTTCATCTTCCTGGTGAGGACAGCAAAAGGAGCAGGCACT

TGGCTGGGGGTGGGGTGTTGGTTTTTGTTTTGGAATAAACAGCTGTTTTCCTGA
Translation
 - UNI35890 - MAPRTPKNLYNTMKPSNLD - UNI35890 - DNLHYNVNSPKHHAATLD DWRAMPPPSPSLHYSTLSCSRSFHNLSHLPPSYE

AAVKSELNRYSSLKRLA - UNI30653 - AEKDLDEAYLKRRQLEMPRGTLPLHALRRPGTGGGYRMDGWGGPEELGLAPAPNPRRVMSQEHLLGDGS

RASRYEFTLPRARLVSQEHLLLSSPEALRQSREHLLSPPRSPALPPDPTTRASLAASHSNLLLGPGGPPTPLHGLPPSGLHAHHHHALHGSPQPAWMSDA

GGGGGTLARRPPFQRQGTLEQLQFIPGHHLPQHLRTASKNEVTV
Transcript ENSMUST00000066041
Sequence
CCAGGGGGCAGCACAGCCTACGTGGTGTGCGGAGTCATCAGTTTCGCCCTGGCGGTGGGCGTCGGTGCCAAAGTGGCCTTCAGCAAGGCGTCACGTGCAC

CCAGGGCGCACCGGGAGATCAACGTGCCCAG - UNI35890 - AGCTCTCGTGGATATTCTCAGGCATCAAGCAGGACCTGCAACCCGCCCGGACCGG

GCCAGAAGCAGTTCTCTGACCCCAGGGCTGGGAGGCCCAGACAGCATGGCCCCAAGGACACCCAAGAACCTTTACAACACCATGAAGCCCTCCAACCTCG

 - UNI35890 - ATAACCTGCACTACAACGTCAACAGCCCCAAGCACCACGCCGCCACACTGG ACTGGCGTGCTATGCCGCCGCCCAGCCCCTCCCT

GCACTACTCCACACTATCCTGCTCCCGATCCTTCCACAACCTCTCTCATCTTCCCCCGTCCTATGAGGCTGCTGTGAAATCAGAACTGAATCGATACTCT

TCCCTCAAGAGACTGG - UNI30653 - CTGAGAAAGATCTGGATGAAGCCTACCTGAAGCGCAGACAACTGGAGATGCCGCGCGGAACGCTGCCCTT

GCATGCACTCCGGCGGCCTGGCACTGGAGGTGGCTACCGTATGGATGGCTGGGGTGGCCCTGAGGAGCTGGGCCTGGCACCAGCACCCAACCCACGGCGT

GTTATGTCCCAGGAGCACCTTCTGGGTGATGGTAGCCGAGCTTCCCGCTATGAGTTCACGTTGCCTCGAGCGCGCCTGGTGTCTCAGGAACACCTGCTGC

TGTCCTCACCTGAGGCGCTTCGCCAGAGTCGCGAGCACCTGCTGTCACCCCCACGAAGTCCTGCACTGCCCCCAGATCCCACCACCCGGGCCAGCCTGGC

TGCCTCACACTCCAACCTGCTGCTAGGGCCTGGGGGCCCCCCCACACCCCTGCATGGGTTGCCTCCGTCAGGCCTGCATGCCCACCATCACCATGCCCTT

CATGGCTCTCCTCAGCCAGCCTGGATGTCTGATGCGGGCGGGGGTGGGGGCACACTGGCCCGCAGGCCACCCTTCCAGCGCCAGGGCACCCTGGAGCAGC

TGCAGTTCATTCCTGGGCACCACCTGCCCCAGCACCTGCGCACTGCCAGCAAGAACGAAGTGACTGTCTGAGGCCCGGTGGAGTGCTGGGGGCTGTGGCT

TCCGAGGCCCCCTTCTCCCAGCCCAGATCTCCATTACAAGGCTTATCATACACACCAAGGCTCTGAGACCAGATGGGCCCTTGGACCGGAGACCACGCCT

CCTTTTGGGATGTTACAGTAGATGAGATCTCTCCTTTTACTTTGTCACTGTTTGAACCAAGGCCTCCCTCCCATGATGTCATCCCAGAGGAAGGAGGCCT

GTATATGAGGTCATTGCTAGCAAATATGTCTGTGTTTTATGATGTTGTTTGCAGGGACTAAACCTCCTTCCTATGAGGTCACCACAGAGGAAGAGCCCTG

CCTGAGGTCATCACTAGAGGCTATGTCCATTTTGCATGACATCACCACAGAAACTCCTTTCCTGTGATGTCACTACGACAATGCCTTGTCCCATCCCATC

ATCCCTACAAACAAAAATTTCTTCCTGCGTGTCACTACAGAGACAAGTCTCACACTTCTTGACACTTGTTGACATCATCCTGACTGAGCACCAAGGCCTC

TTGCAATTATCATCACAGGAAAAATGTTTCTCTGCCATGGAGAAGATAGCTCCATTCCATGATGCCACCACTACAGACAAAGCCATTTTCCTGGGACACA

TCGCAGTGGACTACGCCCTGCCAGTTATGTCCTCACTAACAATTAGGCCTCCTTTCCACAATACTATCACAGGACTTTGCCTCCCTCCTGTGATGCCATC

ACCAGAATAGGTGCCTTGCCCAATGGCGCCATCACAGGGACTGTGCCTCTTCATGTGATGTCATTACCAGAAATGACCACCTGTTCTTGGGACTTCTCCA

GAGTGAGGCCCTTCTGTGGTGTGACCACCAGTTACCACCCACTTGGAAATGACACCAGGAGACACCTCTATCGCTGTGCCATGTCGTGAGAAAGTTGGGC

ATGTGTAGCCCAAGGCCACCTGGGAAGAGGCCAGAGAAAGTAACCTGTCCTGAGATGTCATGAGGGCGTCAGCACTAGGGATACTAGGGTCTTTCTATAG

GATGCTGGGGGTGATGCCCTCTATTGCTTGGACATCATCATAGAGTGCTTCCTTCTCAGAGGTGTTCCCCACTCTAGATGACCAACAGTAGTGACTGCAT

AATGATTGTGTCATCAGAGTCCTTAAGTCCCT
Translation
VGVGAKVAFSKASRAPRAHREINVPR - UNI35890 - RALVDILRHQAGPATRPDRARSSSLTPGLGGPDSMAPRTPKNLYNTMKPSNLD - UNI3

5890 - DNLHYNVNSPKHHAATLD DWRAMPPPSPSLHYSTLSCSRSFHNLSHLPPSYEAAVKSELNRYSSLKRLA - UNI30653 - AEKDLDEAY

LKRRQLEMPRGTLPLHALRRPGTGGGYRMDGWGGPEELGLAPAPNPRRVMSQEHLLGDGSRASRYEFTLPRARLVSQEHLLLSSPEALRQSREHLLSPPR

SPALPPDPTTRASLAASHSNLLLGPGGPPTPLHGLPPSGLHAHHHHALHGSPQPAWMSDAGGGGGTLARRPPFQRQGTLEQLQFIPGHHLPQHLRTASKN

EVTV

For any suggestions or comments, please send an email to unitrap@crg.es