Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053646 (Plxnb1)
Chromosomal location
Chr 9: 108998106 - 109022422 (+)
Description
plexin B1 Gene [Source:MGI (curated);Acc:Plxnb1-001]
RefSeq_dna
NM_172775 
RefSeq_peptide
NP_766363.1 
UniGene
Mm.53862 Mm.405073 
MGI
MGI:2154238 
Uniprot/SWISSPROT
Q8CJH3 
Uniprot/SPTREMBL
B2RWT9 
Human Ortholog
ENSG00000164050 (PLXNB1)
Omim not available
UniTrap UNI26356
Vector Insertion
Chr 9: 108998160 - 109001784
Public Clones (sanger)
Private Clones OST123562 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38702
Vector Insertion
Chr 9: 109019172 - 109020353
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072093
Sequence
CCCGGAGCTGCGGGCGGACGCCTCGCCGCGCGCATCCCGCAGGAGGGTCGGGCG - UNI26356 - GTGACTCCTGCTCAGGTCATGCCGTTATCTGC

TGATCCAGCCGGCCCTGCCAG GTGACCATGTCTGTCCTCGGCCCAGTTCTTCTCCAGGTGTTCTGGGCCGGGTGTGTCGTCACCCTGCGGTCCCCTCTG

CCAGCTGCTTTCACTGCCAATGGCACACATCTACAACACTTGGCAAGGGACCCCACCACAGGTACCCTCTATGTAGGGGCCACCAACTTCCTGTTCCAGT

TGAGCCCTGGGCTGCAGCTGGAAGCCGTGGTGTCCACGGGCCCTGTGAATGACAGCCGGGATTGCCTGCCACCTGTGATACCTGATGAATGTCCCCAAGC

CCAGCCTACTAACAACCCTAACCAGCTGCTCCTGGTGAGCCCAGAGGCTCTGGTGGTGTGTGGGAGCGTACACCAGGGCATCTGTGAGCTACGGAGCCTG

GGACAGATCAGGCAGCTGCTGCTACGGCCAGAGCGACCTGGGGACACCCAGTATGTGGCTGCAAATGACCCTGCAGTCAGTACAGTGGGGCTGGTGGCCC

AGGGATTGGTAGGGGAGCCCCTCCTGTTTGTGGGGCGGGGGTACACCAGCAGGGGTGTAGGTGGTGGGATTCCTCCCATTACAACCCGAGCCCTGCGACC

ACCGGACCCCCAAGCTGCCTTCTCTTATGAAGAAACAGCCAAGTTAGCAGTGGGCCGCCTGTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGTACGC

GGGGCCAGTGCATACTTCCTGTTCTTGCGGCGAGACCTGAAGGCCCCTTCTAGAGCTTTCCGTGCCTATGTGTCTCGAGTGTGCCTTCAGGACCAGCACT

ACTACTCTTATGTGGAATTGCCCCTGGCCTGCCAGGGTGGTCGTTACGGTCTTATCCAGGCTGCAGCTGTAGCCACGTCCAAGGAGGTGGCCCGTGGGGA

CGTACTCTTTGCAGCTTTCTCCTCAGTGGCTCCTCCCACTGTGGATTGGCCCCTGTCAGCATCTACTGGGGCATCTGGAACCTCTGTGCTCTGTGCCTTC

CCCCTGGATGAGGTAGACCAGCTTGCTAATTACACTCGAGATGCCTGTTATACTCGGGAAGGCCGTGCTGAGAACGGGACCAAGGTTGCTGACATTGCAT

ACGATGTCCTTTCCGACTGTGCGCAGCTACCAGTG GACACCCCGGATGCTTTTCCATGTGGCTCTGACCACACACCCAGTCCCATGGTCAGCTGTGTCC

CTTTGGAAGCCACGCCAATTCTGGAGCTACCAGGGGTTCAGCTAACAGCTGTGGCTGTCACCATGGAGGATGGACACACTATTGCTTTCCTGGGTGACAG

TCAAGGACAGTTGCATAGG GTCTACTTAGGCCCTGGAAGAAGTGCTGCCCCATATTCTAAACAGAGCATCCAGCCGGGGTCTCCTGTGAACAGAGATCT

TACCTTTGATGGTACCTTTGAGCATCTCTATGTAGCAACTCAGACTACT CTTGTGAAGGTTCCTGTGGCTCCTTGTGCTCAGCATCTGGACTGTGACTC

TTGCCTTGCTCACAGGGACCCTTATTGCGGATGGTGTGTGCTCCTGGGCAG GTGTAGTCGCCGGTCGGAGTGCTCAAGGGACCAGGGCCCAGAGCAGTG

GCTGTGGAGCTTCCAGCCGGAACTGGGCTGTCTTCGAGTGGTGGCCGTGAGCCCTGCCAATATCAGTCGGGAAGAGAGGAGGGAG GTTTTCTTGTCAGT

GCCAGGCCTGCCATCTCTCTGGCCAGGGGAGTCATATTTCTGCTACTTTGGAGACCAACAGAGTCCTGCTCTACTGACCAGTTCTGGTGTGATGTGTCCC

TCCCCAGACCCCAGTGAGGCTCCAGTGCTGCAGAGAGGAGCCG ACCATATCTCTGTGAACGTGGAGCTCAGGTTTGGTGCCGTGGTGATCGCCAGCACC

TCCCTCTCCTTCTATGACTGCGTGGCAGTTACTGCGTCTTCCCCATCTGCACC GTGCCGGGCCTGTGTGAGCAGCCGCTGGGGCTGTAACTGGTGTGTG

TGGCAGCAGCTGTGCACACACAAGGCCTCGTGTGACGCTGGGCCTATGGTGGCAAGCCAACAG AGCCCACTCCTTCCCCTAATCCCTCCTGCAAGGGAT

GAACTCACCCCTTTCCCACCCACAGTCCCCCAAACCACGGTCACTCCTACCCCCAACAGCTTCCCAATAGAGCCTAGGGCTCCCTCCACAGCCTCAGATG

TCCTACCTGGGGCCAAGCCTTCCCGGCTCAGCCTCTGGGGCCCATGGGCAGGTCCTGGCCCCATACTTTCCCCTACTTCCACAGAGTCACCTCTTCATGA

GAAGCCCCTTCCTCCTGACCCCCCTACCATACCTGGAACCACTGTCCCTGCCCCCACTGGCTTGGGACCATCGACCACACCTGAGGACCTCTTGGCCTCC

TACCCATTCCCCTCAGATGCAGCTGCAGTGTCCCCTGCAGAGCCTGGCCCTGAGGCTCTGCCTTCCATGGTGGCTCTGGACCAGCCCCCTGGCACTGTTC

CAGACACTACTTTCCCAGGGGCCCCTGGCTCCATGAAGCCCGTTCTGGATTGGCTCACCAAAGGAGGCGGCGAGCTGCCCGAGGCGGATGAGTGGATGGG

GGGTGACACGCCCGCCTTCTCCACTTCCACACTCCTCTCAGGTGATGGAGACTCAGCAGAGCACGAGGGCCCTCCTGCCCCCCTCATCCTCCTGTCCAGC

CTCGACTACCAGTACGACACCCCCGGGCTCTGGGAGCTG GGAGAGGTGAATCAGAGGGTGAGCTCCTGCCCCTGTGTGGAGACCGTCCAGGGCTCCTTG

CTGATACCGGTCCATGTGGAACGCGAAGTCCAGCTTCGAGGCAGGAACCTGTGGCTTTTCCAG GATGGCCCGAGGAGCAGCGAGTGTGTGCTGGAGCTA

GGGAGTCGGGAGGTGGCTGTGGAGGCTCAGGTGGAGTGTGCGCCGCCTCCAGATGTCTGGTGCCACATCAAGTGCCAGCAGCATCAG TTCAGCTATGAA

GCTTTGAAGCCAGAACTGCAGGTGGGGCTGTTCCTGCGTTGGGCAGGCGGTCTGCGCGTGGACAGTGCCGATGGGCTGCATG TGGTGTTGTATGACTGC

TCTGTGGGACATGGGGACTGCAGCCGCTGCCAAACTGCCATGCCTCAGTACGACTGTGTGTGGTGTGAGGGGGAGCGTCCGCGTTGTGTGGCCCGGGAAG

CCTGTAATGAAGCCGAGACTGTGGCCACTCAGTGCCCCGCACCTCTCATTCACTCG GTGGATCCACTGACTGGACCTATAGATGGAGGCACCCGTGTCA

CTATCAGGGGCTCCAACCTGGGCCAACATGTGCAGGATGTCCTGGACATGGTCAGAGTGGCCGGAGTTCCCTGCGCTGTGGATGCTGGGGAGTATGATGT

CTCTAGTAG TCTTGTGTGCATCACTGGAGCCAGCGGGGAGGAGGTGACTGGCACTGTGGCAGTGGAGGTGCCTGGAAGAGGACACGGTGTCTCAGAGTT

CAGCTTTGCCTATCAG GATCCAAAAGTACACTCCATCTTCCCAGCCCGTGGCCCTAGAGCTGGAGGTACCCGCCTTACCCTGCATGGTTCTAAGCTCCT

GACTGGACGGCTAGAGGACATCCGTGTGGTGGTTGGAGACCAGCCTTGCCACCT GCTCCTGGAGCAGCAGTCTGAGCAGCTACACTGTGAGACCGGCCC

ATACCCTGTGCCTGCTGAACTTCCAGTGACTGTCTTGTTTGGGGCCACTGAGCGGAGGCTTCAGCACGGCCAATTCAAGTATACATCAGACCCCAATGTC

ACCTCAGTGGGCCCCTCCAAGAGCTTCTTCAG CGGAGGACGTGAGATATGGGTCCGCGGCCAGGATCTTGATGTGGTACAGAGGCCAAGAATCCGAGTG

ACCGTGGTCCCAAGACAGCATGGCCAGGGGCTTGCACAGAAGCAACACGTGGTCCCTGAGAAA TTTGAGGAGCCGTGTCTCGTGAACTCCTCCCACCTC

CTCATGTGCCGCACTCCCGCTCTCCCTGGCCCACCCTGGGACTCTGGGGTCCAGGTGGAGTTTATCCTCGACAACATGGTCTTTGACTTTGCTGCACTGA

GCCCCACACCCTTCTCCTATGAGGCTGATCCCACCCTGCGTTCCCTGAACCCCGAGGATCCCAGCACGCCGTTCCGGCACAAGCCAGGGAGTGTGTTCTC

TGTGGAG GGGGAGAATCTGGACCTCGCCATGTCTAAAGAAGAGGTGGTGGCCATGATAGGGGACGGGCCCTGCGTGGTAAAGACACTGACCCGGAACCA

CCTGTACTGTGAGCCCCCTGTGGAGCAGCCCCTGCCACATCCCCATGCCCTCCGAGAGGCTCCAGATGCTTTGCCTGAGTTCACG GTACAGATGGGCAA

CCTGCGCTTCTCCTTGGGTCATGTGCAGTACGATGGCGAGAGCCCCGTGGCTTTTCCTGTGGCAGCCCAAGTGGGCTTGGGAGTGGGCACGTCTCTCCTG

GCTCTGGGTGTCATCATCATTGTCCTCATATACAG GAGGAAGAGCAAGCAGGCCCTGAGGGACTATAAGAAAGTGCAGATCCAGCTGGAGAACCTGGAG

AGCAGTGTACGGGACCGCTGTAAGAAGGAGTTTACAG ACCTCATGACGGAGATGACGGATCTCACCAGTGACCTCCTTGGCAGCGGTATCCCCTTCCTT

GACTACAAAGTGTATGCTGAGAGGGTCTTCTTCCCTGGGTACCGGGAGTCCCCCTTGCACAGGGACCTCGGTGTGCCTGACAGCAGGCGACCCACCGTGG

AACAGGGCCTGGGGCAGCTCTCCAACCTGCTAAACAGCAAGCTCTTCCTTACCAAG TTCATCCACACACTGGAGAGTCAGCGCACCTTCTCTGCTCGGG

ACCGTGCCTACGTGGCATCTCTGCTCACTGTTGCACTTCACGGGAAGCTTGAATACTTCACGGACATACTGCGGACTCTGCTCAGTGACCTGGTAGCTCA

GTATGTTGCCAAGAACCCCAAGCTGATGCTGCGCAG GACAGAGACCGTGGTAGAAAAGCTGCTCACCAACTGGATGTCCATCTGCCTCTACACCTTTGT

GAGG GACTCTGTGGGAGAGCCTCTGTATATGCTCTTCAGAGGGATTAAGCATCAAGTGGACAAGGGTCCCGTGGACAGTGTGACTGGCAAAGCCAAATA

CACTCTGAATGACAACCGCCTGCTCAGAGAGGATGTGGAGTACCGTCCCTTG ACCTTGAATGCTCTTCTGGCTGTGGGGCCTGGGGCAGGAGAAGCCCA

GTGTGTACCTGTGAAAGTCCTGGACTGTGACACCATCTCCCAGGCCAAGGAGAAGATGCTAGACCAGCTTTACAAGGGAGTGCCTCTTGCCCAGCGGCCC

GACTCTTGCACCTTGGATGTTG AATGGCGGTCTGGAGTGGCTGGGCACCTTATCCTTTCTGATGAGGACGTCACTTCCGAACTCCAGGGTCTGTGGAGG

CGTCTGAATACACTGCAACATTACAAG GTCCCAGATGGAGCAACGGTGGCCCTTGTCCCCTGCCTCACCAAGCATATTCTTAGGGAAAACCAGGATTAT

GTCCCTGGGGAAC GGACCCCAATGCTGGAGGATGTAGATGAGGGGGGCATCCGGCCCTGGCACCTGGTAAAGCCGAGTGATGAACCAGAGCCTCCCAGG

CCGAGGAGGGGCAGCCTTCGGGGTGGGGAGCGTGAGCGAGCCAAGGCTATCCCTGAGATCTACCTGACACGCCTGCTATCCATGAAG GGCACACTGCAG

AAGTTTGTGGATGACCTGTTCCAGGTGATTCTCAGCACCAGCCGCCCTGTGCCTCTGGCTGTGAAGTACTTCTTTGACTTGCTGGATGAACAAGCTCAGC

AGCATGGCATCTCTGATCAGGATACTATCCACATCTGGAAGACCAACAG CCTGCCGCTAAGGTTCTGGATCAACATCATCAAGAACCCACAGTTTGTGT

TCGATGTGCAGACTTCGGATAACATGGATGCTGTGCTCCTGGTCATTGCACAGACCTTCATGGATGCTTGCACCCTGGCCGACCACAAGCTGGGCCGG G

ATTCTCCCATCAACAAACTTCTGTATGCTCGAGATATTCCCCGTTACAAACAGATGGTGGAAAG GTACTATGCAGACATCAGACAGACTGTCCCGGCCA

GTGACCAAGAGATGAACTCAGTCTTGGCGGAGCTGTCCCGG AACTGCTCTGCCGACCTTGGGGCGCGAGTGGCTCTGCATGAACTCTACAAGTATATCA

ACAAGTACTATGACCAG ATCATCACTGCCCTGGAGGAGGATGGCACTGCCCAGAAGATGCAGCTGGGCTACCGGCTCCAGCAGATCGCCGCTGCTGTGG

AAAACAAGGTCACGGATCTATAAGGACCAGGGAGTCTTTGCCTGCTGTTGTCTCTGTACCTCCTGGGCAGCCCTGGAATCTCAAGGGAGAGGCCACCACC

TTCGTAGATGCCTGTAGTGACTGACAAGCAGAGTTTAATGAAAGGTGGCTCCCAGTCTCTTGGTGGCACCAGCTCATAGCCTCAGCCCCATTGGACCTGC

CTTGTAGGCCTGGGACCTAGTGGTTCAGTGGGTAGTGCTAGGCCTGCCCCAAGCCTGGTGACTCTCTGACCTACTTCCTGGGTGACGCCAGCCTGCAGGG

AGCTGGGGACTTAAGGTTTCCAGAGAATGTCTGGTAGGCCCTCCAGGCCCCTGGGGAGACTGTACTGTTCTTGAGCACTGACCTATGTCCCATTGGGAAT

CACAGAGGAAGGAAGAGAACCCGCCCGCCCACTTCCTGTCTTCTTCATCCATCCTCCTTGACCTCAAGTTTCGCTTCCTTTGTCCTTGTTCCCTGTTGCC

AATTCCCAGGAGAGAGAGAGGGGGGGGGGAGAGAGAGAGAGAGAGAGAGAGAGAAAGAGATGCATTTCTAGGCTGCTGCTGCCTCAGCAGGGTTGGTGCC

TCAGGACCACCCTGTCTTCCAGGTGGCTGGTGGGGAGGGACAGCTGCTTCAGGGGAGCCTTGGGGAGAGCAGTGACCCATTGATGCTATAGCTCTTCATT

AAAGGATAACACATGGTATGGACTCACCAGCCCCTCTGCTAAGATAGAACTGGCAGCTGCTGGGAGATGTGGGCATCGTGCTCTGAAGGGTCCCCTGACA

CCCACGGAAGGCCACCATGAGGTTGGCAAGCTCTCTCCGGCTCCTAGGTAGGGTCTGCCAGAGGCAACACTCCCCAGAAAGGAGAACTTAAAGCACAATA

AGGCTCAGGGAGAGTTGGGGCCTGAGATGTGGGGTTCTGTCCCCCATCTTTAAGGGGTCCACCTTGATTGCAGGTCGTGGTAACTTTGCCATTCATGTTC

CATGAATTTTTAAAAGAATTGGGGAAGTATGGCGTTATTAAAGGCGATTCCAGGCAGTGTGGGTCTCAGGTCCATGACCCTGTTTCTGGATTCCAGTTTC

CACATTGCTGTCCATGTTAAGGTACCTGAGGCAGGAGCTCAGAGCTACTCACCTGCCTGTGTAGTAGCTACCTTGTGGTATTTTCCTGTTAGAAGCTACA

AGTGAGCTTCAAGACCATGGTACTGTGGTGCACTTGGCAGCTGGCGGTTGAGAATGCCATTGGCTTCACCAGGCAAGGGTCGTGGCATCCTCAGAGAGCT

CCACCTTGGCTCATGTGTATAGCCAGTGATCTGGCCAACCTCAAGCTCTTCCCCAAGTGTTTGAAGACATGGGCTGATACAATTCCAAGAGTCCCTTCTT

GCTGTCTTTTAGAATCTTTGTCTTCAAGATCGCAGGAGCCATTTTGGTTTTCATGCCAGGGGTAATCACAGTGACTATTTCTGTCAGATCCCATCTTCCC

CATGCCTGCCAGATGTGGGGAACCACAGTCACAGACGGCCAGCAGTCAGGCCCTCTTTTGGGAGCATGTGAACTTTAGTACTAATGATAGTTGTCTTAGT

TCAGATTTTATCCTCACGCAGAATGGTTTTGCCTCCCCCAGTGGCTACTCCGACCAACTATGTTGTTGACAGTCTCAGAGAACAGGGCTGACAGGGGGAA

TGAGGTCTTGGCTAGACTTCAGACAGATACAGGAAGGGAGGCACCTTTTAAGTCAACATGGCAGGGATGGTGACAGAGACACACCTCTGCTCCAGGCTTG

AGCTTCTGCAGTCTTTGGGAGTCCTCTGAGGCGGTAAGGGTTCCTGCAGAGGAAGGCCGTGTACCTGCGTGCTTGGGCGTGTGCTCATGGGATGGGCGAG

TATGGAACGTGCTCTGAGTCACTCCTGTCTCACCCTCACAGAACACTGTGATAGAAGATGTCATGAAAATAAAAATGTTACCACTTC
Translation
 - UNI26356 -  MSVLGPVLLQVFWAGCVVTLRSPLPAAFTANGTHLQHLARDPTTGTLYVGATNFLFQLSPGLQLEAVVSTGPVNDSRDCLPPVIP

DECPQAQPTNNPNQLLLVSPEALVVCGSVHQGICELRSLGQIRQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLVGEPLLFVGRGYTSRGVGGGIPPIT

TRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFVRGASAYFLFLRRDLKAPSRAFRAYVSRVCLQDQHYYSYVELPLACQGGRYGLIQAAAVATSK

EVARGDVLFAAFSSVAPPTVDWPLSASTGASGTSVLCAFPLDEVDQLANYTRDACYTREGRAENGTKVADIAYDVLSDCAQLPV DTPDAFPCGSDHTPS

PMVSCVPLEATPILELPGVQLTAVAVTMEDGHTIAFLGDSQGQLHR VYLGPGRSAAPYSKQSIQPGSPVNRDLTFDGTFEHLYVATQTT LVKVPVAPC

AQHLDCDSCLAHRDPYCGWCVLLGR RCSRRSECSRDQGPEQWLWSFQPELGCLRVVAVSPANISREERRE VFLSVPGLPSLWPGESYFCYFGDQQSPA

LLTSSGVMCPSPDPSEAPVLQRGAD DHISVNVELRFGAVVIASTSLSFYDCVAVTASSPSAP PCRACVSSRWGCNWCVWQQLCTHKASCDAGPMVASQ

Q SPLLPLIPPARDELTPFPPTVPQTTVTPTPNSFPIEPRAPSTASDVLPGAKPSRLSLWGPWAGPGPILSPTSTESPLHEKPLPPDPPTIPGTTVPAPT

GLGPSTTPEDLLASYPFPSDAAAVSPAEPGPEALPSMVALDQPPGTVPDTTFPGAPGSMKPVLDWLTKGGGELPEADEWMGGDTPAFSTSTLLSGDGDSA

EHEGPPAPLILLSSLDYQYDTPGLWEL GEVNQRVSSCPCVETVQGSLLIPVHVEREVQLRGRNLWLFQ DGPRSSECVLELGSREVAVEAQVECAPPPD

VWCHIKCQQHQ FSYEALKPELQVGLFLRWAGGLRVDSADGLHV VVLYDCSVGHGDCSRCQTAMPQYDCVWCEGERPRCVAREACNEAETVATQCPAPL

IHS VDPLTGPIDGGTRVTIRGSNLGQHVQDVLDMVRVAGVPCAVDAGEYDVSSS SLVCITGASGEEVTGTVAVEVPGRGHGVSEFSFAYQ DPKVHSI

FPARGPRAGGTRLTLHGSKLLTGRLEDIRVVVGDQPCHL LLLEQQSEQLHCETGPYPVPAELPVTVLFGATERRLQHGQFKYTSDPNVTSVGPSKSFFS

 SGGREIWVRGQDLDVVQRPRIRVTVVPRQHGQGLAQKQHVVPEK FEEPCLVNSSHLLMCRTPALPGPPWDSGVQVEFILDNMVFDFAALSPTPFSYEA

DPTLRSLNPEDPSTPFRHKPGSVFSVE GENLDLAMSKEEVVAMIGDGPCVVKTLTRNHLYCEPPVEQPLPHPHALREAPDALPEFT VQMGNLRFSLGH

VQYDGESPVAFPVAAQVGLGVGTSLLALGVIIIVLIYR RRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTD DLMTEMTDLTSDLLGSGIPFLDYKV

YAERVFFPGYRESPLHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTK FIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVA

KNPKLMLRR RTETVVEKLLTNWMSICLYTFVR DSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPL TLNALLAVGPGAGEAQ

CVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLDVE EWRSGVAGHLILSDEDVTSELQGLWRRLNTLQHYK VPDGATVALVPCLTKHILRENQ

DYVPGER RTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMK GTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLD

EQAQQHGISDQDTIHIWKTNS SLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGR DSPINKLLYARDIPRYKQMVER RYYA

DIRQTVPASDQEMNSVLAELSR NCSADLGARVALHELYKYINKYYDQ IITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL

For any suggestions or comments, please send an email to unitrap@crg.es