Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053654 (Krt42)
Chromosomal location
Chr 11: 100124196 - 100131185 (-)
Description
keratin 42 Gene [Source:MGI (curated);Acc:Krt42-001]
RefSeq_dna
NM_212483 
RefSeq_peptide
NP_997648.2 
UniGene
Mm.158190 
MGI
MGI:1915489 
Uniprot/SWISSPROT
Q6IFX2 
Uniprot/SPTREMBL
Q9CWC9 
Human Ortholog
not available
Omim not available
UniTrap UNI26677
Vector Insertion
Chr 11: 100128597 - 100130723
Public Clones CMHD-GT_410A9-3 (cmhd)
Private Clones OST104361 (lexicon) OST59406 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35217
Vector Insertion
Chr 11: 100126242 - 100127076
Public Clones IST13069E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14057
Vector Insertion
Chr 11: 100124658 - 100125791
Public Clones CMHD-GT_398G3-3 (cmhd) CMHD-GT_106C4-3 (cmhd) CMHD-GT_105G12-3 (cmhd) CMHD-GT_131D7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26741
Vector Insertion
Chr 11: 100124201 - 100124482
Public Clones not available
Private Clones OST100184 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31643
Vector Insertion
Chr 11: 100124201 - 100124658
Public Clones IST12853F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000017270
Sequence
ATGGCTTCCACTACCAGTGTCCGCCAGTTTTCAACTTCTGGCTCCGTTAAGGGCCTTTGTGCTCCCGGCATGGGATTCTCCCGGATGTCCTCTGTTCGTG

TTGGGGGTGCCTGCCGGGCTCCCAGCCTCTTGGGAGGTGGAAGCTGTGGCAATATGTCCGTCACCTCCTCCCGCTTCTCAGCAGGCTTAGGAGGCGGCTA

TGGTGGTGGCTACACTTGCAGCCTGGGTGGGGGCTTTGGCTCCAGTTTTGGTGTGTCGGATGCCCTCCTAGGGGGCAGTGAGAAGGAGACCATGCAGAAT

CTTAATGACCGGCTGGCCACCTACTTAGACAGGGTGCGTGCCCTGGAGGAGGCCAACGCTGACCTGGAGGTGAAGATCCGTGAGTGGTACAAGAAGCAGG

GCCCCGGACCGGCTCGTGACTACAGCCCCTACTTCAAGACCATAGAGGACCTGCGGAACAAG - UNI26677 - ATCCTGGCAGCCACAATCGACAAC

GCCAGCATCGTGCTGCAGATTGACAACGCTCGCCTGGCAGCCGATGACTTCCGCACCAA GTACGAGACAGAGCTGAACCTGCGCATGAGCGTGGAGGCC

GACATCAATGGCCTGCGCCGGGTGCTGGATGAACTGACCCTGGCCAGAGCCGACCTGGAAATGCAGATCGAGAGCCTGAAGGAGGAGCTGGCCTATCTGA

GGAAGAACCATGAGGAG - UNI35217 - GAAATGAATGCCCTTCGTGGCCAGGTGGGCGGGGACGTCAATGTGGAGATGGACGCCGCCCCCGGTGTG

GACCTGAGCCGCATCCTGAACGAGATGCGGGATCAGTATGAGAAGATGGCGGAGAAGAACCGCAAGGATGCTGAGGAATGGTTCTTCACCAAG - UNI3

5217 - ACAGAGGAGCTGAACCGAGAAGTGGCCACCAACACGGAGGCCCTGCAGAGCAGCCGGACAGAGATCACGGAGCTCCGCCGCTCTGTGCAGAAC

CTGGAGATTGAGCTGCAGTCCCAGCTCAGCATG - UNI35217 - AAAGCATCACTGGAGAACAGCCTGGCAGAGACAGAGGCGCGCTATGGGGCCCA

GCTGGCGCAGCTGCAGGGCCTCATTAGCAGTGTGGAACAGCAGCTGTGTGAGCTGCGTTGTGACATGGAAAGGCAGAATCATGAGTACCAGGTGCTGCTG

GATGTGAAGACCCGACTGGAGCAGGAGATCGCCACCTACCGCCGTCTGCTGGAGGGCGAGGACGCCCA - UNI14057 - - UNI31643 - CCTGG

CTACTCAATACTCCTCATCCCTGGCTTCGCAGCCCTCCCGAGAAG - UNI26741 - - UNI31643 - GCATGGTGACCAGCCGCCAGGTGCGCAC

CATTGTGGAGGAAGTCCAGGATGGTAAGGTGGTCTCCTCCAGAGAGCAGGTGCACCGCTCCACCCACTGAGGCCCCTGTCTGCGTATGATAGCCCAGGCC

CAGGACCTTAGGCTGCAGCTCCCTGCATCTACTGCCAAGCCTGAACTCCTATGAGCTAGCTGTTGCCTTCTGTGTTTGCTTTGTGCTGCCCCTTACAGAG

AGGCCCCTTGGGTTGACCCCAGAAATTGCTAATAAAGCTTTGAAGAAGTCTG
Translation
MASTTSVRQFSTSGSVKGLCAPGMGFSRMSSVRVGGACRAPSLLGGGSCGNMSVTSSRFSAGLGGGYGGGYTCSLGGGFGSSFGVSDALLGGSEKETMQN

LNDRLATYLDRVRALEEANADLEVKIREWYKKQGPGPARDYSPYFKTIEDLRNK - UNI26677 - ILAATIDNASIVLQIDNARLAADDFRTK KYE

TELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLRKNHEE - UNI35217 - EMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQY

EKMAEKNRKDAEEWFFTK - UNI35217 - TEELNREVATNTEALQSSRTEITELRRSVQNLEIELQSQLSM - UNI35217 - KASLENSLAETE

ARYGAQLAQLQGLISSVEQQLCELRCDMERQNHEYQVLLDVKTRLEQEIATYRRLLEGEDAH - UNI14057 - - UNI31643 - HLATQYSSSLA

SQPSREG - UNI26741 - - UNI31643 - GMVTSRQVRTIVEEVQDGKVVSSREQVHRSTH
Transcript ENSMUST00000107406
Sequence
ATACAAATTCGAATGTAGGTGCTAGGCGCGCTTGTGTTAGAGTGTTTGTTAGGGGAGACTGATGGAATCCACAGTCCAATGAGTACAGGGCCTGTCCTCC

GTGTGGCAGCTTCACCCGGGAGTTGCTGGCCTGGCTGTCTACCTGCTTTCCTGAGATCCAGGGACTTTTCCCAGAATGGCTTTGGGTGACCTCCTGCTGT

CTGTCCTCTCTGCCCAGGAAATGAATGCCCTTCGTGGCCAGGTGGGCGGGGACGTCAATGTGGAGATGGACGCCGCCCCCGGTGTGGACCTGAGCCGCAT

CCTGAACGAGATGCGGGATCAGTATGAGAAGATGGCGGAGAAGAACCGCAAGGATGCTGAGGAATGGTTCTTCACCAAG - UNI35217 - ACAGAGG

AGCTGAACCGAGAAGTGGCCACCAACACGGAGGCCCTGCAGAGCAGCCGGACAGAGATCACGGAGCTCCGCCGCTCTGTGCAGAACCTGGAGATTGAGCT

GCAGTCCCAGCTCAGCATG - UNI35217 - AAAGCATCACTGGAGAACAGCCTGGCAGAGACAGAGGCGCGCTATGGGGCCCAGCTGGCGCAGCTGC

AGGGCCTCATTAGCAGTGTGGAACAGCAGCTGTGTGAGCTGCGTTGTGACATGGAAAGGCAGAATCATGAGTACCAGGTGCTGCTGGATGTGAAGACCCG

ACTGGAGCAGGAGATCGCCACCTACCGCCGTCTGCTGGAGGGCGAGGACGCCCA - UNI14057 - - UNI31643 - CCTGGCTACTCAATACTCC

TCATCCCTGGCTTCGCAGCCCTCCCGAGAAG - UNI26741 - - UNI31643 - GCATGGTGACCAGCCGCCAGGTGCGCACCATTGTGGAGGAAG

TCCAGGATGGTAAGGTGGTCTCCTCCAGAGAGCAGGTGCACCGCTCCACCCACTGAGGCCCCTGTCTGCGTATGATAGCCCAGGCCCAGGACCTTAGGCT

GCAGCTCCCTGCATCTACTGCCAAGCCTGAACTCCTATGAGCTAGCTGTTGCCTTCTGTGTTTGCTTTGTGCTGCCCCTTACAGAGAGGCCCCTTGGGTT

GACCCCAGAAATTGCTAATAAAGCTTTGAAGAAGTCTGATCCTT
Translation
MALGDLLLSVLSAQEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTK - UNI35217 - TEELNREVATNTEALQSS

RTEITELRRSVQNLEIELQSQLSM - UNI35217 - KASLENSLAETEARYGAQLAQLQGLISSVEQQLCELRCDMERQNHEYQVLLDVKTRLEQEIA

TYRRLLEGEDAH - UNI14057 - - UNI31643 - HLATQYSSSLASQPSREG - UNI26741 - - UNI31643 - GMVTSRQVRTIVEEVQ

DGKVVSSREQVHRSTH

For any suggestions or comments, please send an email to unitrap@crg.es