Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000053852 (Gpr112)
Chromosomal location
Chr X: 54125728 - 54233529 (+)
Description
G protein-coupled receptor 112 Gene [Source:MGI (curated);Acc:Gpr112-003]
RefSeq_peptide
NP_001104260.1 
UniGene
Mm.35282 Mm.473626 
MGI
MGI:2685213 
Uniprot/SPTREMBL
Q3UNS7 Q80T58 
Human Ortholog
ENSG00000156920 (GPR112)
Omim not available
UniTrap UNI26107
Vector Insertion
Chr X: 54147429 - 54148045
Public Clones not available
Private Clones OST137230 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30049
Vector Insertion
Chr X: 54230908 - 54233256
Public Clones D138C09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096431
Sequence
AATGGTATTTTGGTGTCCACACATCTGTGGCTAATTTAAATAGTGTCTTAATGTAACAGACCCACACCTGTTGGGTTAGGATCCTTCCCCCTGAATAACA

GTTTTGGTTTTTGTTTGTTTGTTTGTTTGCTTGCTTGCTTGTTTGTTTTTCTTTTTGCCTTGGCTTGACCACTCTAGGAATCCCAGCAATCACAGTGGCC

ATTATACTCAGTGTAAGAAAAGACCTGTATGGAACTCTGAGCCCAACAACTCCATT TTGTTGGATTAAAGACGATCACATCTTTTACATCTCCGTGGTG

GCTTATTTTTGCCTCATATTTCTCATGAATCTCTCCATGTTCTGCACGGTTCTCGTTCAATTGACTTCTGTGAAATCCCAAAGCCAGAAGACTCGGAAGA

AAATGATCCTGAATGACCTCAAAGGCACAATCAGTTTGACATTTCTACTTGGCCTCACCTGGGGCTTTGCCTTTTTTGCCTGGGGACCTGTGAGGATCTT

CTTCTTGTATCTTTTTGCCATTTGTAATACATTGCAAG GGTTCCTCATTTTTGTGTTTTACTGTGTGATGAAGGAAAGTGTTCGGGAGCAGTGGCACAT

GCCCCTCCACTGCAGGTGGCTTCGGCTGGAGAACTTTGCAG GTTGGATAAATGTTAGGCATAAACAGAAGAGACTGAAGAAAAACAATGAGTCCAAATT

ATTGACACCATCGCTCATGTCAACAACAACTTTCAAATCTATAGGATCTGTACCCAGCATTCCTTCAGAAATAAACTTCTCAAATG - UNI30049 - 

GTGACTTTGATGATAGTCCAGACACGTTCTCTTTCTTGAGTTGTAAAGCTGCACCTACTTTTATAAGAAGAGCATTGCCTGCAGAAATCCAAACAAATTC

CACTCAGAAACAAAGATCATTTCCCATAAATGTCAGCAGAGATACCCACCTGACTCCCAGCTCTGGACTGGGGGAAATGTTCAATTTATAAATCAAATCT

GCCACTATCTTGTATTCTAAAGATTGTTTTGGAAGAGGCAGAATGAAATCATATTTAATAAATAATCAGCCTT
Translation
 MNLSMFCTVLVQLTSVKSQSQKTRKKMILNDLKGTISLTFLLGLTWGFAFFAWGPVRIFFLYLFAICNTLQG GFLIFVFYCVMKESVREQWHMPLHCR

WLRLENFAG GWINVRHKQKRLKKNNESKLLTPSLMSTTTFKSIGSVPSIPSEINFSNG - UNI30049 - GDFDDSPDTFSFLSCKAAPTFIRRALP

AEIQTNSTQKQRSFPINVSRDTHLTPSSGLGEMFNL
Transcript ENSMUST00000066533
Sequence
ATGACTAACAGCTCACATTACTGGATGGCCTTCATCTACATTACTAATAACACTCTCCTGGGCAGAGAAGATGTAGACCTTGGACTCGCAGGAGACCATC

AGCAGCTGATACTGTACAGCTTTGGCAAGACCTTCTATGTCAGTTATCACCTGATTCCATTTCATTGGCATACCCTGTGCTTGGTATGGGATGGTGTGAA

GGGCAGATTAGAGCTCTTCCGGAACAAAGAAAGGATACTTGCAATAATGGATCAGCCACACAGACTGTCTCCTAATGGGACTTTGGTCTTGGGACACTTT

CCCAGGAATGGAGAGGGTCAGATTAAAACTGTGATACCTCGCTTTACAAGCAGCCTGTATTACTTTCAGCTCTGGGACCGCATCCTGGAAAATGAGGAGT

TTATGACATGTTTCTATGGAAATGTAGTTAGTTGGGAAGATGATGTTTGGCTCATCCACAAGATAAGTCCAACTGTTGACAGGAGACTGCGCTGCT - U

NI26107 - TTGTTTCTGAAAATATGACAATTCAAGAAACAAGTACAAATGTTTCACAGCAAATAGACCTAACAACTTCTTCCCAAACTACTGGACTTA

ACCCACACAAGACTTCACATTCATCCACACTGTTGCCAGAAGGCATGGCTGATTCTACAATCAACAGTACAGCCATATCATATGCTAATACAGTACCCTC

ACCTCTAGCAACAGTAAGTGCAGCCAAAGATTTGAAGACATCTACAACCGAGACAGCTACATTTTTAACAGATACCTTGTTTACTTCAACAGCCACCCCT

CTGCCTACCCAGACTGTAACAGAACACTCATATCTAGGAAAAACAAGGACATCAAAAAGGGTGGAGGCCATGGCTACTGAGATCTTTCATTCAGCTACAG

CTACTGATTTAATTGACACATCTGTGTTTACTAAGAATTATACTGTATCTGAAACTTCAACAACTAAGTCCAAGTCAGCTGTTGGGAAGACAACTTTATT

CTTGAATGAATCAACATCCATAGCTCCAACACCTTGTCCCAAGCACAAATCCACAGATGTTGCTATACTCCATACCTCTAAATCTGGGCAAGAATTTCTT

GTATCTTCAGCTGCCAGAACTGTGTCTTGGTCCACATTAGAAGAGACTTCACCTATTACTACTGATGTTGGGATTGTATCAACCTTCCCACCAGAGTCTT

TGCTTACCTCCACAGCTTCTCCTGTGAGTTCTACATTTCCTGAAATTCAGTTAGCATCTACCTTGTCAACAACTGATTCAGAAATGGCATCAACAGTCCA

TTCAGTGTTGCCTATGCAGACCATACCTACCCCAAGAACAGTGAAACCAGAGTCAGGCTCTACAAATTTCCAAGATGTCTTTTCACCCAGCATGGAGGAT

GCTCTATCTGTCTCCATGCCTAAAGAAACCACTTTCATGGCCTTTTCTTCCATTACCTCCTCTCCAATCACCAGAACTCAAGATGAACAGATAGCTATTG

ATGCTGAGAGTACACATCTAACCATAATCCCCGGAACCAAATTTGTCCCTACATTGGCTGAAGCTTCACTCTTCCCTACCATTGAAGGGCAAGCATACAC

TCAGGATACACCCACAACGGATGAGCCCATGCTTACTTTGACTTCTACTAAATCACCTTCTACATATAACGCATCTGAATCAGTTCTCACATCTATAACA

ATTAAAAGTGACTATCAGTTCTTCACCAATGAGACCACTTGGACTTCTAAGTCAGGTCAGAACCTGTTGACCTCTATGAATACAACCACTATACCCACAT

TCACATCTAATAAAACTCTCACATTACCATTCCAAGGTAATGCCACTAATAGAGATCATTCATCCATGACTACTAACGTCTCACCAATTGAAGCATCCAC

GGAGAGCAAAGTGACTACCAGCTCTGATGCTACTACAGCCAGTTATACAACAGCTTTATTCAAACCAACATCCCAGTGGCTTAGTCATTTCACGAGTGTT

TCTGGAATCACATCTATAGCCAGCCAGCCTGAATCTAAACTCACCACCTTATTATTGAAAAGCAACTCTATGCCCACAGTAGCTACAAATGAATTTCCCT

CAATACCAAGTGAGCCAGTTGCTCCATCAGTGAATACGTCTACCCTCACTGACATTAAACCAAATTTTTCTACAGAGAAGAGCATTTCTGAGACAATACA

AATAGAAACAAATGGTGTGAGCTCATTTGGTGATACTCTGGCCCCTCTGCCCATGTCTGCAACAACACAGAGAGTCTATACCACTGTGACAAAAGAAACC

ACTTCCCGTCATCCTAAGGTAAAGTCAACTATATCAACAGTAGCTGAGGCTTCTCCATTTTCAACAATGCTGGAAGTGACAGATGAATCAGAACAAATGG

TGACAGCTTCTGTCACTATTTCCCCCTTTACAGATATAGAAAAATTGACTACTGCATTGAGTAAAGAAACTGCAACTGCAGAGGTGGGAGTGAGTTGGCT

TTCAACCAAATTAAAGGAAAGCATGCCTGAGAGTTCACACAATGGAACCACAGAAAGCTTTAACTCGACCCATACCTACACAGTAGATTGGACTTCAGAA

AAATCCAAGGGTAACTCAGCTTCATCACCCAATTCTGCAAGCACCCAGGCACTACCTGAACTTCCAAGTTCTTCAACAATGAAGACGATGGGAGTCACTT

TCTCCACTAATTCTTCACAGAGGACAGCTGCATCTTTGTCTGCTGGTATCTTGTCTCCACAGACTGCCTCTACTCATGCCTTAGTAACTCCCCAACTGCT

TACACACACGTTTTCACTGCCAGTTAATATCTCTGCTGTCACCTCTCCTAAAACCACTATGGTGTTTTTTGATGAGACTAAGGTGACCCTGTCTCAGCCT

TCTACATTGGCCAGGGATTTCACTACATCTATGCCCTCAGTTGGTTCAACTCTACCAACAGTGACAATGACCACAGAGTTGGTGCCACCAGTGAGTCCAA

CAGCTTCCACAATTAGTGATAGCATGTTTACTCACAGAGACTTACTTCATACCACTTCAGAGGTCACAACGATCTCTTCCACAACAGCACACATGGCAAT

TTCCTCTCTGAGAGAGACTTTGGTATCCTCACTGAGACCTCCCACTCCTGTGATAACTAAGGCTATAAGTACCATTCCCTCCATCTCATCTGACTCAGTA

AGTCCATCCATACACACTCTTGTCTGCTCAAGGCCTTCCCCTAATAACGTTACTATTGTATCCTCTACTTATGTTAGCTCAACTACATCCACATCAGTAG

CAACACCATCTGAATCTCATTTTAGTTTTCCCTATGCTTTTAGTAGTGGTGGAGATGTCACTATGGCTTCTGGACCCACAGGGACCTCTGCTGGTGGTGA

GGCCATGCCCCCTAACACCTTTGTCAATAAATTTATTACCTCAGTAGACCATGAATCTACCACATATTTTGTGAATACACCAGTCTCCACACAGTCAGTG

TTTGCCACCTCTATGGTATCTTCTGACAAAGAACAGACCAACATCTCCATGGAGAAAACCCTCAGAACTACAGGGGTGGCAGAGATTTCTCCATCCAAAA

ATTCCTTTATTTTGGACTCCCAGAGCACTTTCCCTTGGGAAATGACAGACACAGAACTTTCTGAGACCACAGAAATCTCCAGCCACCAAACACATTTGCC

TTCAGAAATTCTTCCTGGTTATTCAGATTCTGGGAATTTAACCACATTTTCTACTTCTGGGAGCACACAGTCTGCCCAAACCTTGTCCTCAAGCACCATA

ATAGGTGTTCGTGTTTCAGAGGGGTCAACTAGTCTTGAGAAAACGGCACTCCCTTCACAAGTTCAGACAGTAACCAAATCTTTGACTCATGATAAAGAAA

GGACAAGTGCCCTTTCAGAATATCCTCCCAGGACTGTAGAAAAGATCATGAGCTCCTCTCCTGTGACTCATCAAGCCACAGGTCACCTAGCTACTTCAAT

TGTAGATGCTTCCAGGACAACTAGAATATCACATCCTGTGCTCATCAACACAACTCTTTCATACCTACTTTCACTTAAGACGAAACCTGAAGCAACACAG

ATTGCTTCTTCCACTTCTGGAAGCACAGAGAATTTCCCTAACTCCTTCTCTCCTTTCACAACTGGACTTCTGAGCACCAATTTTACAATGATCACTCCCA

ATGGGAGCACTACAGTCCTTTCTATTCCAAATGAACCAACAAACCTTCCTAAGAAGACTTCTATGGAGGCGTCAACTCCTATTTCCCAAATGGATTTGTT

GGCCCTCAATGTCACTGCTTTCACCTCTAAAAAAGTTTCTGACACCCATACAATGCTAATGACCAAGTCTTCTAGAACAATACACATAGGCACTTTGAAA

AGTGTCTCTATAGGTACCTTTGGGCTTAAGTCTGAAAAGTCTGAAATGCCAGTTAATAACTCTGATTTCTCAACTACAGTGCTTTATTCTGACACTTCCA

CAAGACTTGGGGAATTCTTTACTTCATCGTCTTCACTTCCCCCTAAGGCTACTAAAACCACCCAAGCATCCACATTGAATACCACACCAGTGGCACATGC

TGGGCCTACTTCACAAAGAACAGTGTTTTCCTCTACTTTCTCGAATTCCTCAGTGGTAGAGGTACCACTCAATTACACAACTGCACACTTTTCCTCTCCA

ACACAGAGAGGTTTTTTATCTATGAAAACTATTCCAACCACTAGTATGGCTGGAATATCAACTTCAGTTATAGGTGCTACTTCTTCCTCTCTGTCCAGTT

CTAAGAATACTGAACCTATTTCCTCCATTCCAAAGACCATGTTTTCATTGTTACTTTCAACAACCCAGCAACCATCACAAGAAAATGGGGCTCCCACTCT

GGACATATTACCTGGGATCACTGTGAGCAGTGGTGGGGCGACAGATCTCATTAATGCCAATTCCAGAGCCACCATCCCTGCAAATGAGCTTTCAACTACT

CCTTCAGATAATTTTTATACTTTCTTGAATACTCAGGATTCCCCAACTTTGACTAACTCTAAAGTGACCCCTAGACCTACAGAAAGTGTAAAATCCACAC

CTACTCACCTTTCCTTTGATACTAGAAAGATGAACATTTTAACTGAACTAACAAAGAGTGGTCCATGTGTGACTACTCCTGTTTTATACCCTTTGTGGAC

CCAGACCAGTACAGCTCCACCTTTGACATCACATCTTTACTCACCTCATAGTACCAAGGCCAAGTTTCCACTTGCATCTCAAATGGCTGAATATCCAGCA

TGGGCTACAGGAATCACACCTAGTATCACCCAGGCTCTGCTTACCACGTCCAGAAACACACAAAGAGTTGAAGACTCTCCCTTTCCAGTTTTCACAACGA

AGGTAATGACACCCAACAGAATGGAAGTAGAGACTCTGCACTCTCCTTCTGGGACTTTGGCAACATCCACAACCTCTCAGATCGGTCTGGTCTCTAGGGA

TGTTACAGTGATGCCATTGATTTCCACATCAGAAAGCCTTCCTTCTTTAGGGATTTCTGAGAGTACTTCATTGTCAATATCTTCCACATTTCCCCCTACC

ACTTTGGCTGCTATTCTGCCCACATTTGAGAAAACAGCCATGCCTGTAACCCCTGGAATCACACTTTCATCAAATCCTTCTGTAAATTCTAGGGCTACCT

CCCCCACTTGGAGCTCATCTAGTCTCCCTTCAGACTCTCGGGCATCCATATTTACTCCTTCTCGGCTTTTAACTTCATCTTCAGGAGAAATGTCAGAATC

CACTTTTCCAGCTTCTGATATTATAGCAACATACTCTAACTTTACAGTGGCACCCCTTTCTGATGGAAGTGCCACCATAGCCACCCAAGCCACTTCTACA

ACTACACTGGACATCATCACTGCTAACTCTTTGACTTCTCCACCCATACCTTCAAAGGACAAAGATGGCAGTCTACACACTTCTACATTCCTTGAATCAT

CTCTGAGAACTACTGGGGCTGACAGCTCCACAGATATGTCTGAACGCATGTCCTTTGGTAGAACGAGTATATCACCTTCTCTAACAAGGCATGACCTATC

TATTGGTTCTCTGACCGTATCTAGCCCTACAAATACATCTCCATGGAGTAAAGTCCCAGTTACATCAGAATCTCACACTTTATTTCCTTCTAAATCTACA

CTGGACTCTGTTATGAGTACAGCCACTACTACATCCACAGCTATAGGAACCTCATTTCCCCTGATGTCTACTGAGATGGCACATCCTTCTACAGCAACTG

GGTTTTCACTAGTGTCTTCATCTTTTGAGACAACATGGATGGACTCCATATTTTCCTCTCTATTTACACAACCATCTACTTCACCAACTGCCAAAGAGTC

TACAG AGCCAGGAAAATGTGAAGCAGATGAAACACCCTCAAAATACAAAGGGACATATAAGTGGCCATTAACTGACCCTACTGAGACAGCCCAAGAAAG

GTGCATTAAAAATGAGAATAGGAACGCCACAAGAATTTG TTCCATCAGCATCCAGACTGGCAAGTGTCAATGGGAAAAACCAAGGCTTAAGCAGTGCAA

GTTGCTCCAAGGACTCCCTGATAAGATTGTGGATCTTGCTAATATCACCATAAGTGATG AGAATGCGGATGATGTCGCAGAGCACATTTTAAATCTGGT

CAATGAGTCTCCACCTTTGGATGAAGAAGAGACAAAGATTATTGTTTCTAAAGTAGCTGATATTTCTAACTGTGATGAGATAAGTATCAACCTAACCCAG

ATCATACTCCAAATCCTCAACACTGTGACGGAAAAGCAGAGTGATTCAGCTTCCAACCTGCCTCCAGTAAGCAATGA GATTCTGAGGATAATTGAGCGT

GTTGGTCACAAGATGGAATTTGCAGGGAGAACAGCAAATCTCACTGTAGCTAAGCTGGCTTTGGCTGTGCTGCGGGTAGACCACAAGTTTGAAGGTATGG

CCTTCAGCATCCAATCCTCTGAAGAAGTCATAGCCCCCCAG GCTAAAACCATCACTTCTGAATTAATGACATATGTTGTGAGTGCAAGCATCTCAAATA

CTTCCATTCAAAACTTGGCTGATCCAGTGATTATCATTCTAAAGCATATTCAAGGAGACTGG AATTATGATCAAGTTTACTGTGCCTTTTGGGATTTTG

ACACTAACA ATGGGCTAGGTGGATGGAATCCATCAGGCTGTAAACTCAAGGAAAGCAATATAAATTATACAATCTGTCAGTGTAACCACCTCACCCACT

TTGGAGTCTTAATG GATTTGTCCAGGTCTACAGTGGATGCAGTAAATGAACGGATATTAGTGATTATAACATATACAGGATGTGGGATCTCCTCCATTT

TCCTGGGGATTGCCATGGTGACATACATAGCTTTCCA CAAACTTCGAAAAGATTATCCTTCCAAAATCCTGATCAACCTATGCACAGCGTTACTGATGC

TCAACCTAGCCTTTCTGGTGAACTCCTGGCTGACATCATTTCAGAAAGTAGGACTATGTATCACGGCTGCAGTGGCACTCCATTACTTTCTCCTCGTGTC

TTTGACTTGGATGGGCCTGGAAGCAGTCCACATGTACTTTGCTTTAGTCAAAGTCTTCAACACATACATTCCAAATTATATCCTTAAGTTTTGTCTGGCT

GGCTGGG GAATCCCAGCAATCACAGTGGCCATTATACTCAGTGTAAGAAAAGACCTGTATGGAACTCTGAGCCCAACAACTCCATT TTGTTGGATTAA

AGACGATCACATCTTTTACATCTCCGTGGTGGCTTATTTTTGCCTCATATTTCTCATGAATCTCTCCATGTTCTGCACGGTTCTCGTTCAATTGACTTCT

GTGAAATCCCAAAGCCAGAAGACTCGGAAGAAAATGATCCTGAATGACCTCAAAGGCACAATCAGTTTGACATTTCTACTTGGCCTCACCTGGGGCTTTG

CCTTTTTTGCCTGGGGACCTGTGAGGATCTTCTTCTTGTATCTTTTTGCCATTTGTAATACATTGCAAG GGTTCCTCATTTTTGTGTTTTACTGTGTGA

TGAAGGAAAGTGTTCGGGAGCAGTGGCACATGCCCCTCCACTGCAGGTGGCTTCGGCTGGAGAACTTTGCAG GTTGGATAAATGTTAGGCATAAACAGA

AGAGACTGAAGAAAAACAATGAGTCCAAATTATTGACACCATCGCTCATGTCAACAACAACTTTCAAATCTATAGGATCTGTACCCAGCATTCCTTCAGA

AATAAACTTCTCAAATG - UNI30049 - GTGACTTTGATGATAGTCCAGACACGTTCTCTTTCTTGAGTTGTAAAGCTGCACCTACTTTTATAAGAA

GAGCATTGCCTGCAGAAATCCAAACAAATTCCACTCAGAAACAAAGATCATTTCCCATAAATGTCAGCAGAGATACCCACCTGACTCCCAGCTCTGGACT

GGGGGAAATGTTCAATTTATAAATCAAATCTGCCACTATCTTGTATTCTAAAGATTGTTTTGGAAGAGGCAGAATGAAATCATATTTAATAAATAATCAG

CCTT
Translation
MTNSSHYWMAFIYITNNTLLGREDVDLGLAGDHQQLILYSFGKTFYVSYHLIPFHWHTLCLVWDGVKGRLELFRNKERILAIMDQPHRLSPNGTLVLGHF

PRNGEGQIKTVIPRFTSSLYYFQLWDRILENEEFMTCFYGNVVSWEDDVWLIHKISPTVDRRLRCF - UNI26107 - FVSENMTIQETSTNVSQQID

LTTSSQTTGLNPHKTSHSSTLLPEGMADSTINSTAISYANTVPSPLATVSAAKDLKTSTTETATFLTDTLFTSTATPLPTQTVTEHSYLGKTRTSKRVEA

MATEIFHSATATDLIDTSVFTKNYTVSETSTTKSKSAVGKTTLFLNESTSIAPTPCPKHKSTDVAILHTSKSGQEFLVSSAARTVSWSTLEETSPITTDV

GIVSTFPPESLLTSTASPVSSTFPEIQLASTLSTTDSEMASTVHSVLPMQTIPTPRTVKPESGSTNFQDVFSPSMEDALSVSMPKETTFMAFSSITSSPI

TRTQDEQIAIDAESTHLTIIPGTKFVPTLAEASLFPTIEGQAYTQDTPTTDEPMLTLTSTKSPSTYNASESVLTSITIKSDYQFFTNETTWTSKSGQNLL

TSMNTTTIPTFTSNKTLTLPFQGNATNRDHSSMTTNVSPIEASTESKVTTSSDATTASYTTALFKPTSQWLSHFTSVSGITSIASQPESKLTTLLLKSNS

MPTVATNEFPSIPSEPVAPSVNTSTLTDIKPNFSTEKSISETIQIETNGVSSFGDTLAPLPMSATTQRVYTTVTKETTSRHPKVKSTISTVAEASPFSTM

LEVTDESEQMVTASVTISPFTDIEKLTTALSKETATAEVGVSWLSTKLKESMPESSHNGTTESFNSTHTYTVDWTSEKSKGNSASSPNSASTQALPELPS

SSTMKTMGVTFSTNSSQRTAASLSAGILSPQTASTHALVTPQLLTHTFSLPVNISAVTSPKTTMVFFDETKVTLSQPSTLARDFTTSMPSVGSTLPTVTM

TTELVPPVSPTASTISDSMFTHRDLLHTTSEVTTISSTTAHMAISSLRETLVSSLRPPTPVITKAISTIPSISSDSVSPSIHTLVCSRPSPNNVTIVSST

YVSSTTSTSVATPSESHFSFPYAFSSGGDVTMASGPTGTSAGGEAMPPNTFVNKFITSVDHESTTYFVNTPVSTQSVFATSMVSSDKEQTNISMEKTLRT

TGVAEISPSKNSFILDSQSTFPWEMTDTELSETTEISSHQTHLPSEILPGYSDSGNLTTFSTSGSTQSAQTLSSSTIIGVRVSEGSTSLEKTALPSQVQT

VTKSLTHDKERTSALSEYPPRTVEKIMSSSPVTHQATGHLATSIVDASRTTRISHPVLINTTLSYLLSLKTKPEATQIASSTSGSTENFPNSFSPFTTGL

LSTNFTMITPNGSTTVLSIPNEPTNLPKKTSMEASTPISQMDLLALNVTAFTSKKVSDTHTMLMTKSSRTIHIGTLKSVSIGTFGLKSEKSEMPVNNSDF

STTVLYSDTSTRLGEFFTSSSSLPPKATKTTQASTLNTTPVAHAGPTSQRTVFSSTFSNSSVVEVPLNYTTAHFSSPTQRGFLSMKTIPTTSMAGISTSV

IGATSSSLSSSKNTEPISSIPKTMFSLLLSTTQQPSQENGAPTLDILPGITVSSGGATDLINANSRATIPANELSTTPSDNFYTFLNTQDSPTLTNSKVT

PRPTESVKSTPTHLSFDTRKMNILTELTKSGPCVTTPVLYPLWTQTSTAPPLTSHLYSPHSTKAKFPLASQMAEYPAWATGITPSITQALLTTSRNTQRV

EDSPFPVFTTKVMTPNRMEVETLHSPSGTLATSTTSQIGLVSRDVTVMPLISTSESLPSLGISESTSLSISSTFPPTTLAAILPTFEKTAMPVTPGITLS

SNPSVNSRATSPTWSSSSLPSDSRASIFTPSRLLTSSSGEMSESTFPASDIIATYSNFTVAPLSDGSATIATQATSTTTLDIITANSLTSPPIPSKDKDG

SLHTSTFLESSLRTTGADSSTDMSERMSFGRTSISPSLTRHDLSIGSLTVSSPTNTSPWSKVPVTSESHTLFPSKSTLDSVMSTATTTSTAIGTSFPLMS

TEMAHPSTATGFSLVSSSFETTWMDSIFSSLFTQPSTSPTAKESTE EPGKCEADETPSKYKGTYKWPLTDPTETAQERCIKNENRNATRIC CSISIQT

GKCQWEKPRLKQCKLLQGLPDKIVDLANITISDE ENADDVAEHILNLVNESPPLDEEETKIIVSKVADISNCDEISINLTQIILQILNTVTEKQSDSAS

NLPPVSNE EILRIIERVGHKMEFAGRTANLTVAKLALAVLRVDHKFEGMAFSIQSSEEVIAPQ AKTITSELMTYVVSASISNTSIQNLADPVIIILKH

IQGDW NYDQVYCAFWDFDTNN NGLGGWNPSGCKLKESNINYTICQCNHLTHFGVLM DLSRSTVDAVNERILVIITYTGCGISSIFLGIAMVTYIAFH

 HKLRKDYPSKILINLCTALLMLNLAFLVNSWLTSFQKVGLCITAAVALHYFLLVSLTWMGLEAVHMYFALVKVFNTYIPNYILKFCLAGWG GIPAITV

AIILSVRKDLYGTLSPTTPF FCWIKDDHIFYISVVAYFCLIFLMNLSMFCTVLVQLTSVKSQSQKTRKKMILNDLKGTISLTFLLGLTWGFAFFAWGPV

RIFFLYLFAICNTLQG GFLIFVFYCVMKESVREQWHMPLHCRWLRLENFAG GWINVRHKQKRLKKNNESKLLTPSLMSTTTFKSIGSVPSIPSEINFS

NG - UNI30049 - GDFDDSPDTFSFLSCKAAPTFIRRALPAEIQTNSTQKQRSFPINVSRDTHLTPSSGLGEMFNL
Transcript ENSMUST00000114762
Sequence
ATGAGAAAACACATACTACATCAGAGGCTTTGTGGATTGATTCTTGTTTCGAGTTTTATCTTTCTCACAG - UNI26107 - ATTCACTTTCATTGAA

AGGAAAAAGGCTTGATTTTTATGGAGAAGGCAAGGCATATGTCAGCCTGACCTACACGATGCCCGAACTCAGCCGACTCACAGCATGTATTGATCTGATA

TCGATGACTAACAGCTCACATTACTGGATGGCCTTCATCTACATTACTAATAACACTCTCCTGGGCAGAGAAGATGTAGACCTTGGACTCGCAGGAGACC

ATCAGCAGCTGATACTGTACAGCTTTGGCAAGACCTTCTATGTCAGTTATCACCTGATTCCATTTCATTGGCATACCCTGTGCTTGGTATGGGATGGTGT

GAAGGGCAGATTAGAGCTCTTCCGGAACAAAGAAAGGATACTTGCAATAATGGATCAGCCACACAGACTGTCTCCTAATGGGACTTTGGTCTTGGGACAC

TTTCCCAGGAATGGAGAGGGTCAGATTAAAACTGTGATACCTCGCTTTACAAGCAGCCTGTATTACTTTCAGCTCTGGGACCGCATCCTGGAAAATGAGG

AGTTTATGACATGTTTCTATGGAAATGTAGTTAGTTGGGAAGATGATGTTTGGCTCATCCACAAGATAAGTCCAACTGTTGACAGGAGACTGCGCTGCT 

- UNI26107 - TTGTTTCTGAAAATATGACAATTCAAGAAACAAGTACAAATGTTTCACAGCAAATAGACCTAACAACTTCTTCCCAAACTACTGGAC

TTAACCCACACAAGACTTCACATTCATCCACACTGTTGCCAGAAGGCATGGCTGATTCTACAATCAACAGTACAGCCATATCATATGCTAATACAGTACC

CTCACCTCTAGCAACAGTAAGTGCAGCCAAAGATTTGAAGACATCTACAACCGAGACAGCTACATTTTTAACAGATACCTTGTTTACTTCAACAGCCACC

CCTCTGCCTACCCAGACTGTAACAGAACACTCATATCTAGGAAAAACAAGGACATCAAAAAGGGTGGAGGCCATGGCTACTGAGATCTTTCATTCAGCTA

CAGCTACTGATTTAATTGACACATCTGTGTTTACTAAGAATTATACTGTATCTGAAACTTCAACAACTAAGTCCAAGTCAGCTGTTGGGAAGACAACTTT

ATTCTTGAATGAATCAACATCCATAGCTCCAACACCTTGTCCCAAGCACAAATCCACAGATGTTGCTATACTCCATACCTCTAAATCTGGGCAAGAATTT

CTTGTATCTTCAGCTGCCAGAACTGTGTCTTGGTCCACATTAGAAGAGACTTCACCTATTACTACTGATGTTGGGATTGTATCAACCTTCCCACCAGAGT

CTTTGCTTACCTCCACAGCTTCTCCTGTGAGTTCTACATTTCCTGAAATTCAGTTAGCATCTACCTTGTCAACAACTGATTCAGAAATGGCATCAACAGT

CCATTCAGTGTTGCCTATGCAGACCATACCTACCCCAAGAACAGTGAAACCAGAGTCAGGCTCTACAAATTTCCAAGATGTCTTTTCACCCAGCATGGAG

GATGCTCTATCTGTCTCCATGCCTAAAGAAACCACTTTCATGGCCTTTTCTTCCATTACCTCCTCTCCAATCACCAGAACTCAAGATGAACAGATAGCTA

TTGATGCTGAGAGTACACATCTAACCATAATCCCCGGAACCAAATTTGTCCCTACATTGGCTGAAGCTTCACTCTTCCCTACCATTGAAGGGCAAGCATA

CACTCAGGATACACCCACAACGGATGAGCCCATGCTTACTTTGACTTCTACTAAATCACCTTCTACATATAACGCATCTGAATCAGTTCTCACATCTATA

ACAATTAAAAGTGACTATCAGTTCTTCACCAATGAGACCACTTGGACTTCTAAGTCAGGTCAGAACCTGTTGACCTCTATGAATACAACCACTATACCCA

CATTCACATCTAATAAAACTCTCACATTACCATTCCAAGGTAATGCCACTAATAGAGATCATTCATCCATGACTACTAACGTCTCACCAATTGAAGCATC

CACGGAGAGCAAAGTGACTACCAGCTCTGATGCTACTACAGCCAGTTATACAACAGCTTTATTCAAACCAACATCCCAGTGGCTTAGTCATTTCACGAGT

GTTTCTGGAATCACATCTATAGCCAGCCAGCCTGAATCTAAACTCACCACCTTATTATTGAAAAGCAACTCTATGCCCACAGTAGCTACAAATGAATTTC

CCTCAATACCAAGTGAGCCAGTTGCTCCATCAGTGAATACGTCTACCCTCACTGACATTAAACCAAATTTTTCTACAGAGAAGAGCATTTCTGAGACAAT

ACAAATAGAAACAAATGGTGTGAGCTCATTTGGTGATACTCTGGCCCCTCTGCCCATGTCTGCAACAACACAGAGAGTCTATACCACTGTGACAAAAGAA

ACCACTTCCCGTCATCCTAAGGTAAAGTCAACTATATCAACAGTAGCTGAGGCTTCTCCATTTTCAACAATGCTGGAAGTGACAGATGAATCAGAACAAA

TGGTGACAGCTTCTGTCACTATTTCCCCCTTTACAGATATAGAAAAATTGACTACTGCATTGAGTAAAGAAACTGCAACTGCAGAGGTGGGAGTGAGTTG

GCTTTCAACCAAATTAAAGGAAAGCATGCCTGAGAGTTCACACAATGGAACCACAGAAAGCTTTAACTCGACCCATACCTACACAGTAGATTGGACTTCA

GAAAAATCCAAGGGTAACTCAGCTTCATCACCCAATTCTGCAAGCACCCAGGCACTACCTGAACTTCCAAGTTCTTCAACAATGAAGACGATGGGAGTCA

CTTTCTCCACTAATTCTTCACAGAGGACAGCTGCATCTTTGTCTGCTGGTATCTTGTCTCCACAGACTGCCTCTACTCATGCCTTAGTAACTCCCCAACT

GCTTACACACACGTTTTCACTGCCAGTTAATATCTCTGCTGTCACCTCTCCTAAAACCACTATGGTGTTTTTTGATGAGACTAAGGTGACCCTGTCTCAG

CCTTCTACATTGGCCAGGGATTTCACTACATCTATGCCCTCAGTTGGTTCAACTCTACCAACAGTGACAATGACCACAGAGTTGGTGCCACCAGTGAGTC

CAACAGCTTCCACAATTAGTGATAGCATGTTTACTCACAGAGACTTACTTCATACCACTTCAGAGGTCACAACGATCTCTTCCACAACAGCACACATGGC

AATTTCCTCTCTGAGAGAGACTTTGGTATCCTCACTGAGACCTCCCACTCCTGTGATAACTAAGGCTATAAGTACCATTCCCTCCATCTCATCTGACTCA

GTAAGTCCATCCATACACACTCTTGTCTGCTCAAGGCCTTCCCCTAATAACGTTACTATTGTATCCTCTACTTATGTTAGCTCAACTACATCCACATCAG

TAGCAACACCATCTGAATCTCATTTTAGTTTTCCCTATGCTTTTAGTAGTGGTGGAGATGTCACTATGGCTTCTGGACCCACAGGGACCTCTGCTGGTGG

TGAGGCCATGCCCCCTAACACCTTTGTCAATAAATTTATTACCTCAGTAGACCATGAATCTACCACATATTTTGTGAATACACCAGTCTCCACACAGTCA

GTGTTTGCCACCTCTATGGTATCTTCTGACAAAGAACAGACCAACATCTCCATGGAGAAAACCCTCAGAACTACAGGGGTGGCAGAGATTTCTCCATCCA

AAAATTCCTTTATTTTGGACTCCCAGAGCACTTTCCCTTGGGAAATGACAGACACAGAACTTTCTGAGACCACAGAAATCTCCAGCCACCAAACACATTT

GCCTTCAGAAATTCTTCCTGGTTATTCAGATTCTGGGAATTTAACCACATTTTCTACTTCTGGGAGCACACAGTCTGCCCAAACCTTGTCCTCAAGCACC

ATAATAGGTGTTCGTGTTTCAGAGGGGTCAACTAGTCTTGAGAAAACGGCACTCCCTTCACAAGTTCAGACAGTAACCAAATCTTTGACTCATGATAAAG

AAAGGACAAGTGCCCTTTCAGAATATCCTCCCAGGACTGTAGAAAAGATCATGAGCTCCTCTCCTGTGACTCATCAAGCCACAGGTCACCTAGCTACTTC

AATTGTAGATGCTTCCAGGACAACTAGAATATCACATCCTGTGCTCATCAACACAACTCTTTCATACCTACTTTCACTTAAGACGAAACCTGAAGCAACA

CAGATTGCTTCTTCCACTTCTGGAAGCACAGAGAATTTCCCTAACTCCTTCTCTCCTTTCACAACTGGACTTCTGAGCACCAATTTTACAATGATCACTC

CCAATGGGAGCACTACAGTCCTTTCTATTCCAAATGAACCAACAAACCTTCCTAAGAAGACTTCTATGGAGGCGTCAACTCCTATTTCCCAAATGGATTT

GTTGGCCCTCAATGTCACTGCTTTCACCTCTAAAAAAGTTTCTGACACCCATACAATGCTAATGACCAAGTCTTCTAGAACAATACACATAGGCACTTTG

AAAAGTGTCTCTATAGGTACCTTTGGGCTTAAGTCTGAAAAGTCTGAAATGCCAGTTAATAACTCTGATTTCTCAACTACAGTGCTTTATTCTGACACTT

CCACAAGACTTGGGGAATTCTTTACTTCATCGTCTTCACTTCCCCCTAAGGCTACTAAAACCACCCAAGCATCCACATTGAATACCACACCAGTGGCACA

TGCTGGGCCTACTTCACAAAGAACAGTGTTTTCCTCTACTTTCTCGAATTCCTCAGTGGTAGAGGTACCACTCAATTACACAACTGCACACTTTTCCTCT

CCAACACAGAGAGGTTTTTTATCTATGAAAACTATTCCAACCACTAGTATGGCTGGAATATCAACTTCAGTTATAGGTGCTACTTCTTCCTCTCTGTCCA

GTTCTAAGAATACTGAACCTATTTCCTCCATTCCAAAGACCATGTTTTCATTGTTACTTTCAACAACCCAGCAACCATCACAAGAAAATGGGGCTCCCAC

TCTGGACATATTACCTGGGATCACTGTGAGCAGTGGTGGGGCGACAGATCTCATTAATGCCAATTCCAGAGCCACCATCCCTGCAAATGAGCTTTCAACT

ACTCCTTCAGATAATTTTTATACTTTCTTGAATACTCAGGATTCCCCAACTTTGACTAACTCTAAAGTGACCCCTAGACCTACAGAAAGTGTAAAATCCA

CACCTACTCACCTTTCCTTTGATACTAGAAAGATGAACATTTTAACTGAACTAACAAAGAGTGGTCCATGTGTGACTACTCCTGTTTTATACCCTTTGTG

GACCCAGACCAGTACAGCTCCACCTTTGACATCACATCTTTACTCACCTCATAGTACCAAGGCCAAGTTTCCACTTGCATCTCAAATGGCTGAATATCCA

GCATGGGCTACAGGAATCACACCTAGTATCACCCAGGCTCTGCTTACCACGTCCAGAAACACACAAAGAGTTGAAGACTCTCCCTTTCCAGTTTTCACAA

CGAAGGTAATGACACCCAACAGAATGGAAGTAGAGACTCTGCACTCTCCTTCTGGGACTTTGGCAACATCCACAACCTCTCAGATCGGTCTGGTCTCTAG

GGATGTTACAGTGATGCCATTGATTTCCACATCAGAAAGCCTTCCTTCTTTAGGGATTTCTGAGAGTACTTCATTGTCAATATCTTCCACATTTCCCCCT

ACCACTTTGGCTGCTATTCTGCCCACATTTGAGAAAACAGCCATGCCTGTAACCCCTGGAATCACACTTTCATCAAATCCTTCTGTAAATTCTAGGGCTA

CCTCCCCCACTTGGAGCTCATCTAGTCTCCCTTCAGACTCTCGGGCATCCATATTTACTCCTTCTCGGCTTTTAACTTCATCTTCAGGAGAAATGTCAGA

ATCCACTTTTCCAGCTTCTGATATTATAGCAACATACTCTAACTTTACAGTGGCACCCCTTTCTGATGGAAGTGCCACCATAGCCACCCAAGCCACTTCT

ACAACTACACTGGACATCATCACTGCTAACTCTTTGACTTCTCCACCCATACCTTCAAAGGACAAAGATGGCAGTCTACACACTTCTACATTCCTTGAAT

CATCTCTGAGAACTACTGGGGCTGACAGCTCCACAGATATGTCTGAACGCATGTCCTTTGGTAGAACGAGTATATCACCTTCTCTAACAAGGCATGACCT

ATCTATTGGTTCTCTGACCGTATCTAGCCCTACAAATACATCTCCATGGAGTAAAGTCCCAGTTACATCAGAATCTCACACTTTATTTCCTTCTAAATCT

ACACTGGACTCTGTTATGAGTACAGCCACTACTACATCCACAGCTATAGGAACCTCATTTCCCCTGATGTCTACTGAGATGGCACATCCTTCTACAGCAA

CTGGGTTTTCACTAGTGTCTTCATCTTTTGAGACAACATGGATGGACTCCATATTTTCCTCTCTATTTACACAACCATCTACTTCACCAACTGCCAAAGA

GTCTACAG TTTCCTTCTACAATATTAAAATGAGCTTCTCTGTCTTTGATGAAGAGCCAAGGGTCCTCGTTACCACTGTTATACATGACCTTACAAAAGA

TTGG TTGAATTTTATGTTTCAGAACAGTGAATTTTCTCTTGCTAATCTGGCTATTCAAATTAAAAGCAG AAAGACTTCCAAAGAAGAGACAGCCATGT

ACAGATACATTGTAA AACAGAAAAAAGGTCAAGGAATGGATGCAATTTTTCATGTACCATACAG TTGTGCCTGTTGGGTTATCATAAAAGCCAAGTCT

TCTTTAGAATCTGTGGAACTGATCAGCAGCATCCGAACTAAAATACATGGGAACCTCACACATGGGAACTTCACACAAGATCAATTGACTCTATTGGTAA

AGTCTGACCATGTTGTAGTGGAAAAGCTAG AGCCAGGAAAATGTGAAGCAGATGAAACACCCTCAAAATACAAAGGGACATATAAGTGGCCATTAACTG

ACCCTACTGAGACAGCCCAAGAAAGGTGCATTAAAAATGAGAATAGGAACGCCACAAGAATTTG TTCCATCAGCATCCAGACTGGCAAGTGTCAATGGG

AAAAACCAAGGCTTAAGCAGTGCAAGTTGCTCCAAGGACTCCCTGATAAGATTGTGGATCTTGCTAATATCACCATAAGTGATG AGAATGCGGATGATG

TCGCAGAGCACATTTTAAATCTGGTCAATGAGTCTCCACCTTTGGATGAAGAAGAGACAAAGATTATTGTTTCTAAAGTAGCTGATATTTCTAACTGTGA

TGAGATAAGTATCAACCTAACCCAGATCATACTCCAAATCCTCAACACTGTGACGGAAAAGCAGAGTGATTCAGCTTCCAACCTGCCTCCAGTAAGCAAT

GA GATTCTGAGGATAATTGAGCGTGTTGGTCACAAGATGGAATTTGCAGGGAGAACAGCAAATCTCACTGTAGCTAAGCTGGCTTTGGCTGTGCTGCGG

GTAGACCACAAGTTTGAAGGTATGGCCTTCAGCATCCAATCCTCTGAAGAAGTCATAGCCCCCCAG ATTTTCCTCGGTGATATCCCTCTAAGGAAGGCT

TTGGCTTCCATCTATTTGCCTAAATCATTGAGGGAAAAGGTTCCTCTTGATGGCTTGCAAACTATCTTGTTTAATTTTTTTGGCCAAACCTCACTCTTTA

AG GCTAAAACCATCACTTCTGAATTAATGACATATGTTGTGAGTGCAAGCATCTCAAATACTTCCATTCAAAACTTGGCTGATCCAGTGATTATCATTC

TAAAGCATATTCAAGGAGACTGG AATTATGATCAAGTTTACTGTGCCTTTTGGGATTTTGACACTAACA ATGGGCTAGGTGGATGGAATCCATCAGGC

TGTAAACTCAAGGAAAGCAATATAAATTATACAATCTGTCAGTGTAACCACCTCACCCACTTTGGAGTCTTAATG GATTTGTCCAGGTCTACAGTGGAT

GCAGTAAATGAACGGATATTAGTGATTATAACATATACAGGATGTGGGATCTCCTCCATTTTCCTGGGGATTGCCATGGTGACATACATAGCTTTCCA C

AAACTTCGAAAAGATTATCCTTCCAAAATCCTGATCAACCTATGCACAGCGTTACTGATGCTCAACCTAGCCTTTCTGGTGAACTCCTGGCTGACATCAT

TTCAGAAAGTAGGACTATGTATCACGGCTGCAGTGGCACTCCATTACTTTCTCCTCGTGTCTTTGACTTGGATGGGCCTGGAAGCAGTCCACATGTACTT

TGCTTTAGTCAAAGTCTTCAACACATACATTCCAAATTATATCCTTAAGTTTTGTCTGGCTGGCTGGG GAATCCCAGCAATCACAGTGGCCATTATACT

CAGTGTAAGAAAAGACCTGTATGGAACTCTGAGCCCAACAACTCCATT TTGTTGGATTAAAGACGATCACATCTTTTACATCTCCGTGGTGGCTTATTT

TTGCCTCATATTTCTCATGAATCTCTCCATGTTCTGCACGGTTCTCGTTCAATTGACTTCTGTGAAATCCCAAAGCCAGAAGACTCGGAAGAAAATGATC

CTGAATGACCTCAAAGGCACAATCAGTTTGACATTTCTACTTGGCCTCACCTGGGGCTTTGCCTTTTTTGCCTGGGGACCTGTGAGGATCTTCTTCTTGT

ATCTTTTTGCCATTTGTAATACATTGCAAG GGTTCCTCATTTTTGTGTTTTACTGTGTGATGAAGGAAAGTGTTCGGGAGCAGTGGCACATGCCCCTCC

ACTGCAGGTGGCTTCGGCTGGAGAACTTTGCAG GTTGGATAAATGTTAGGCATAAACAGAAGAGACTGAAGAAAAACAATGAGTCCAAATTATTGACAC

CATCGCTCATGTCAACAACAACTTTCAAATCTATAGGATCTGTACCCAGCATTCCTTCAGAAATAAACTTCTCAAATG - UNI30049 - GTGACTTT

GATGATAGTCCAGACACGTTCTCTTTCTTGAGTTGTAAAGCTGCACCTACTTTTATAAGAAGAGCATTGCCTGCAGAAATCCAAACAAATTCCACTCAGA

AACAAAGATCATTTCCCATAAATGTCAGCAGAGATACCCACCTGACTCCCAGCTCTGGACTGGGGGAAATGTTCAATTTATAAATCAAATCTGCCACTAT

CTTGTATTCTAAAGATTGTTTTGGAAGAGGCAGAATGAAATCATATTTAATAAATAATCAGCCTT
Translation
MRKHILHQRLCGLILVSSFIFLTD - UNI26107 - DSLSLKGKRLDFYGEGKAYVSLTYTMPELSRLTACIDLISMTNSSHYWMAFIYITNNTLLGR

EDVDLGLAGDHQQLILYSFGKTFYVSYHLIPFHWHTLCLVWDGVKGRLELFRNKERILAIMDQPHRLSPNGTLVLGHFPRNGEGQIKTVIPRFTSSLYYF

QLWDRILENEEFMTCFYGNVVSWEDDVWLIHKISPTVDRRLRCF - UNI26107 - FVSENMTIQETSTNVSQQIDLTTSSQTTGLNPHKTSHSSTLL

PEGMADSTINSTAISYANTVPSPLATVSAAKDLKTSTTETATFLTDTLFTSTATPLPTQTVTEHSYLGKTRTSKRVEAMATEIFHSATATDLIDTSVFTK

NYTVSETSTTKSKSAVGKTTLFLNESTSIAPTPCPKHKSTDVAILHTSKSGQEFLVSSAARTVSWSTLEETSPITTDVGIVSTFPPESLLTSTASPVSST

FPEIQLASTLSTTDSEMASTVHSVLPMQTIPTPRTVKPESGSTNFQDVFSPSMEDALSVSMPKETTFMAFSSITSSPITRTQDEQIAIDAESTHLTIIPG

TKFVPTLAEASLFPTIEGQAYTQDTPTTDEPMLTLTSTKSPSTYNASESVLTSITIKSDYQFFTNETTWTSKSGQNLLTSMNTTTIPTFTSNKTLTLPFQ

GNATNRDHSSMTTNVSPIEASTESKVTTSSDATTASYTTALFKPTSQWLSHFTSVSGITSIASQPESKLTTLLLKSNSMPTVATNEFPSIPSEPVAPSVN

TSTLTDIKPNFSTEKSISETIQIETNGVSSFGDTLAPLPMSATTQRVYTTVTKETTSRHPKVKSTISTVAEASPFSTMLEVTDESEQMVTASVTISPFTD

IEKLTTALSKETATAEVGVSWLSTKLKESMPESSHNGTTESFNSTHTYTVDWTSEKSKGNSASSPNSASTQALPELPSSSTMKTMGVTFSTNSSQRTAAS

LSAGILSPQTASTHALVTPQLLTHTFSLPVNISAVTSPKTTMVFFDETKVTLSQPSTLARDFTTSMPSVGSTLPTVTMTTELVPPVSPTASTISDSMFTH

RDLLHTTSEVTTISSTTAHMAISSLRETLVSSLRPPTPVITKAISTIPSISSDSVSPSIHTLVCSRPSPNNVTIVSSTYVSSTTSTSVATPSESHFSFPY

AFSSGGDVTMASGPTGTSAGGEAMPPNTFVNKFITSVDHESTTYFVNTPVSTQSVFATSMVSSDKEQTNISMEKTLRTTGVAEISPSKNSFILDSQSTFP

WEMTDTELSETTEISSHQTHLPSEILPGYSDSGNLTTFSTSGSTQSAQTLSSSTIIGVRVSEGSTSLEKTALPSQVQTVTKSLTHDKERTSALSEYPPRT

VEKIMSSSPVTHQATGHLATSIVDASRTTRISHPVLINTTLSYLLSLKTKPEATQIASSTSGSTENFPNSFSPFTTGLLSTNFTMITPNGSTTVLSIPNE

PTNLPKKTSMEASTPISQMDLLALNVTAFTSKKVSDTHTMLMTKSSRTIHIGTLKSVSIGTFGLKSEKSEMPVNNSDFSTTVLYSDTSTRLGEFFTSSSS

LPPKATKTTQASTLNTTPVAHAGPTSQRTVFSSTFSNSSVVEVPLNYTTAHFSSPTQRGFLSMKTIPTTSMAGISTSVIGATSSSLSSSKNTEPISSIPK

TMFSLLLSTTQQPSQENGAPTLDILPGITVSSGGATDLINANSRATIPANELSTTPSDNFYTFLNTQDSPTLTNSKVTPRPTESVKSTPTHLSFDTRKMN

ILTELTKSGPCVTTPVLYPLWTQTSTAPPLTSHLYSPHSTKAKFPLASQMAEYPAWATGITPSITQALLTTSRNTQRVEDSPFPVFTTKVMTPNRMEVET

LHSPSGTLATSTTSQIGLVSRDVTVMPLISTSESLPSLGISESTSLSISSTFPPTTLAAILPTFEKTAMPVTPGITLSSNPSVNSRATSPTWSSSSLPSD

SRASIFTPSRLLTSSSGEMSESTFPASDIIATYSNFTVAPLSDGSATIATQATSTTTLDIITANSLTSPPIPSKDKDGSLHTSTFLESSLRTTGADSSTD

MSERMSFGRTSISPSLTRHDLSIGSLTVSSPTNTSPWSKVPVTSESHTLFPSKSTLDSVMSTATTTSTAIGTSFPLMSTEMAHPSTATGFSLVSSSFETT

WMDSIFSSLFTQPSTSPTAKESTV VSFYNIKMSFSVFDEEPRVLVTTVIHDLTKDW LNFMFQNSEFSLANLAIQIKSR RKTSKEETAMYRYIVK KQ

KKGQGMDAIFHVPYS SCACWVIIKAKSSLESVELISSIRTKIHGNLTHGNFTQDQLTLLVKSDHVVVEKLE EPGKCEADETPSKYKGTYKWPLTDPTE

TAQERCIKNENRNATRIC CSISIQTGKCQWEKPRLKQCKLLQGLPDKIVDLANITISDE ENADDVAEHILNLVNESPPLDEEETKIIVSKVADISNCD

EISINLTQIILQILNTVTEKQSDSASNLPPVSNE EILRIIERVGHKMEFAGRTANLTVAKLALAVLRVDHKFEGMAFSIQSSEEVIAPQ IFLGDIPLR

KALASIYLPKSLREKVPLDGLQTILFNFFGQTSLFK AKTITSELMTYVVSASISNTSIQNLADPVIIILKHIQGDW NYDQVYCAFWDFDTNN NGLGG

WNPSGCKLKESNINYTICQCNHLTHFGVLM DLSRSTVDAVNERILVIITYTGCGISSIFLGIAMVTYIAFH HKLRKDYPSKILINLCTALLMLNLAFL

VNSWLTSFQKVGLCITAAVALHYFLLVSLTWMGLEAVHMYFALVKVFNTYIPNYILKFCLAGWG GIPAITVAIILSVRKDLYGTLSPTTPF FCWIKDD

HIFYISVVAYFCLIFLMNLSMFCTVLVQLTSVKSQSQKTRKKMILNDLKGTISLTFLLGLTWGFAFFAWGPVRIFFLYLFAICNTLQG GFLIFVFYCVM

KESVREQWHMPLHCRWLRLENFAG GWINVRHKQKRLKKNNESKLLTPSLMSTTTFKSIGSVPSIPSEINFSNG - UNI30049 - GDFDDSPDTFSF

LSCKAAPTFIRRALPAEIQTNSTQKQRSFPINVSRDTHLTPSSGLGEMFNL

For any suggestions or comments, please send an email to unitrap@crg.es