Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054005 (Mill1)
Chromosomal location
Chr 7: 18830696 - 18851441 (+)
Description
MHC I like leukocyte 1 Gene [Source:MGI (curated);Acc:Mill1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38173
Vector Insertion
Chr 7: 18841322 - 18847787
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000066780
Sequence
GCATTTGAATCAGGGCTGCCTGAGCCCAAAGCATCCTGAGCACCTCTGTGTTTCTCAGCTTCTCTGTACAGGGACCAGCAGCCCTCCAGCCAGCCCAGAC

ACTTTCAGGATCCCCTTTCAGCCTCTTAGGATCCCCCTCCACCTGAAGTCCCAGTGATACCCTTAAGTTCTCCTTGGATTCCTGAGGTTGGTAGAGCTAG

TAAGAGGAGCTCATCTGGCTTGGGATCTTCAAAGTAAACTCAGAAGTCTCAGGCAGAGAGAAGATGCTGCTGTCCAGGAACCTCAGAGCCCTAGCTGCGA

TCCACCTGTGGATAGTGTACCTGCTCCTGGAGGATTTACTGGGCACCTGCGCAG AGGGTGACAACCAAAGACTGGTGGCTTCTGCTCCCTACCAAGATA

TTGAGATCACTCTGGAGAAGCCTAGAGTACAGGCGGTAGCAG - UNI38173 - AACCCCACACTCTGCGCTATGACCTCATGGCCTTGTCTCTGGAG

GTGCCTGGGTTGCCCCAGTTCCTGACCCTGAGATACTTCGATGATGAGCCCTTCCTGCCCTATAAGAAAAACAGCAGCATAACAGACTCCCAGGAACCCA

GGATCAAAGACCATCTGAGAGCTGAGACCTGGGGAAGAGAGACTGACGATCTTCAGGAAGAAGAGGAGCAACTCAAAGGGATGCTAGCTGAGATCACAGC

CCAGAACGGCCAGAATACGG ATCTTCACATCCTCCAGGCAACCTTCGGCTGTGAGCTTCAAAGAAATGGAAGCACTAGAGGCTTCTGGAAACTGGGCTA

TGATGGGCAGAACTTCCTCACCTTTGACCAGAAGACTCTCACATGGACAGTGGATGGACCTTCCACCCAGAAGAACAAGACATTCTGGAAGACACGTGCA

CCCAGAGCTGATCTAGTTAAGACATTCTTGGATGACATATGTCCTGCTCAGCTCCAGAGATACCTTGCTTCCTTGAGAAATGGTCTGCTGAATACAG GT

TTCCCAAAGGTGATTGTGACCTTCAGGAACTATCCAGTGGGCAGGATCACACTGACATGCCGGGCTTTTCGTCTGTATACCCGTGTGGCCACCCTGACCT

GGCTTCAGTATAGAAAGCCAGTACAGCAGAAAACCTTTGGATCTGAAACTATCCTGCCCAGTGGGGATGGCACCTACCAGGCCTGGGTGTCCATTCGGGT

TCTTCCTGGACAGGAATCACAGTTCAGCTGCAACTTGAAGCACGGCAACCACAATATCAATGAACCTGCTGCCACTGAGGCCCCTGTCTATGGTGCGAGA

AGAGAACAACCTCCCACCTCAGGTGTGGGAAGCAGGGTCGGGAAAAGCCTGTGGAGTGCAATGACTACAGCTCTCGTGGTGATCTCCTGGACATTAAGCC

AGAAACTGATGGGGCCTCTACTCTGGTTCTGCTCTGGTGGCTTCTGCTCTTTTCTACAGTGTTGGTAGTTCAAACCCTTGCCTAGAGCAGCAAGAACACG

CAGGAGGACAGCAAGAGACCAGGTGAACATTCCTGCGGGCTGTAGCAGAAGGTGGCAGGAGTGGTGAGAGGCCTTTTCTTCTTTTTGTAAATTGTACAGA

TAGAAAGGTAGTCACACAAGCACCATTTTACCACACTGGTGAATGGAGAGCCCTAAAGAGTTACCATACCGTACCCTAACCTGCCCTGCTGTTGGGAGGC

ACCGCCCCCTGGTGGAAGTGCAATGCTACTTCCGATGTGTTCTTATATATATTATGAAATACAGGGGCAAAGAAGCAGGCTAGACATCCACAACAAAGTA

CGAGTTGTGGCAAACTACACATGCCCCTGCCTCTTCACCAAATACATAGAAAACAAACAGCCAAACAAGACAGAGGAAAAACTGAGAGTCCAAGAGATGA

TCGAGAGTCATTTTACCAGATGATGATAACTATTCCAGTTTTATCTTGATTCAAACACGGGAATTTCTCCTCAAAAGATATCCATGAAGCATCTGGGGGA

GATAGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTACACGTACACAAACACACATATATAAGCATTTAAAAGATTTTGAAGAT

ATCTTATTCTCTATGGTCTCTTTAAATACATACTAATAATCAAAAGGATTCTTAGTATCCCGAGATACAGGATTTCTGCTCTGTCTTCTAAATTAAACTA

CTATTCTTCTGCCTTCATTGTGCCAGCCTAAAATGATCACAGCAAAACTTGTTAAATGTTAATATGCCTCCACAATAAAAGAAGAACAAGTTATCCCAAC

CAATTTTATTTTTAAAATAAAATATAAATTAAAATTAGAAATTATATTACTATAATGGTTTTAAAAAATAAAAATGTTACAAAAATAAAGATATATAGTA

TAAAAATAATAAAATGTTATAAAAATATTAAAATTTATTTTAGTAAAGTTTATGCATGAAGATTAAATGGATATATGGTTACAGAATAAAACACTGAAAT

ATTTTT
Translation
MLLSRNLRALAAIHLWIVYLLLEDLLGTCAE EGDNQRLVASAPYQDIEITLEKPRVQAVAE - UNI38173 - EPHTLRYDLMALSLEVPGLPQFLT

LRYFDDEPFLPYKKNSSITDSQEPRIKDHLRAETWGRETDDLQEEEEQLKGMLAEITAQNGQNTD DLHILQATFGCELQRNGSTRGFWKLGYDGQNFLT

FDQKTLTWTVDGPSTQKNKTFWKTRAPRADLVKTFLDDICPAQLQRYLASLRNGLLNTG GFPKVIVTFRNYPVGRITLTCRAFRLYTRVATLTWLQYRK

PVQQKTFGSETILPSGDGTYQAWVSIRVLPGQESQFSCNLKHGNHNINEPAATEAPVYGARREQPPTSGVGSRVGKSLWSAMTTALVVISWTLSQKLMGP

LLWFCSGGFCSFLQCW

For any suggestions or comments, please send an email to unitrap@crg.es