Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054074 (2810030E01Rik)
Chromosomal location
Chr 2: 17965710 - 17970678 (-)
Description
RIKEN cDNA 2810030E01 gene Gene [Source:MGI Symbol;Acc:MGI:1919918]
MGI
MGI:1919918 
Uniprot/SWISSPROT
Q80YR3 
Human Ortholog
ENSG00000180592 (C10orf140)
Omim not available
UniTrap UNI32079
Vector Insertion
Chr 2: 17969295 - 17970679
Public Clones (cmhd) IST13791F1 (tigm) IST12018E5 (tigm) IST14591B10 (tigm) IST13680E12 (tigm)
IST14859B10 (tigm) IST11551F11 (tigm) IST14634F11 (tigm) IST10416E9 (tigm)
IST14703A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33165
Vector Insertion
Chr 2: 17967236 - 17969967
Public Clones IST11335G8 (tigm) IST13044A10 (tigm) IST14732F4 (tigm) IST13060C8 (tigm)
IST11080H5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091420
Sequence
ATGAAGTCT - UNI32079 - GATGCCTTGAGACACACGCAGCATCTGGCGGAGGATTAACATACATACATGTGTATGTATGCGTCACGTATATATTT

ACTGCAAATGGTGGGGATCATTTAGTGCCCGAGATGGGAGACCTGAAGTCAGGTTTCGAAGAGGTGGATGGCGTGAGGCTCGGCTACCTCATCATTAAAG

GGAAGCAAATGTTTGCTCTCTCCCAAGTCTTCACAGATCTGCTGAAAAACATCCCGAGGACGACCGTGCACAAGCGCATGGATCATCTGAAAGTGAAAAA

GCACCACTGCGATCTGGAGGAGTTGCGGAAACTCAAAGCAATCAACAGTATCGCCTTCCACGCGGCCAAATGCACGCTCATCTCCCGGGAAGACGTAGAA

GCGCTCTACACATCCTGCAAAACCGAGCGTGTGCTCAAGACCAAGCGAAGGAGAGTCGGTCGGGCCCTGGCCACAAAGGCGCCGCCGCCAGAGCGCGCCG

CCGCCGCCAGCCCCCGCCCGGCTTTTTGGAAGGACAAGCACCAACTTTGGCGGGGCCTGAGCGGAGCCGCGCGGCCCCTGCCAATCAGCGCGCAGTCCCA

GCGTCCGGGCGCCGCCGCCGCGCGCCCCGCCGCCCATCTACCTCAGATTTTTAGCAAATACCCGGGCTCCCACTACCCGGAGATCGTTCGCTCGCCTTGC

AAATCCTCTTTAAACTATGAAACTGCCCAGCTCCAGGGAAACTACGTCGCCTTCCACTCGGACCCCGCTTATTTTCGGAGCCTGCTGTGCAGCAAGCACC

CGGC - UNI32079 - - UNI33165 - GGCGGCCGGGGCCACTTGCTTGGAGAGGTTTCATCTGGTCAACAGCTTCTGCCCGCCTCCCCACCACCA

CCATCACCATCACCACCATCATCATCACCATCACCACCGAGCCCAGCAGCCAACGCCGAGTCACCACCCCTCTCATCACCACCGGCCGCAACCCCATCTA

GGAAGCTTTCCCGAGAGTTGTAGCAGCGACTCCGAGTCCAGCTCCTACTCCGACCATGCAGCCAATGACTCGGATTTTGGCTCCAGTTTGTCCAGCTCCA

GCAACTCGGTGTCCTCAGAGGAAGAGGAGGAGGAAGGAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAGGGGGGCAGCGGGGCCTCGGATTCCAGTGA

AATCAGCTCGGAGGAGGAGGATTCTTCCACCGAGTCAGACTCCAGCTCCGGGTCCAGCCAAGTGTCAGTGCAGAGCATCCGTTTCAGGCGCACCAGCTTC

TGCAAGCCTCCCAGCGTGCAGGCGCAGGCCAACTTCTTGTACCATCTGGCCTCCGCCGCCGCTGCAACCAAACCCGCTGCTTTCGAGGATGCCGGCCGAC

TTCCCGACCTCAAGAGTAGTGTCAAAGCCGAGTCACCAGAGGAGTGGAGTCTGCAGAGCTGGGCTCCCAAAGGGACTCCGGTGTACTGCCCGGCCAGCTT

GGGGAGTTGTTTCCCAGAGATAAGAAACGATAGGGTATCTGAGATTACATTCCCACACTCTGAAATATCCAGTACTGTAAAGAGAACTGACCTGACAATT

AACTGCCATGCAGAGGGGGCCTCTTCACCTAGCCCAAAGACAAACAATGTATTTCCACAACAAAGAATACTCCGAGAGGCTAGGAAATGCCTACAAGCAA

CTCCTACTACACACTGTGCAGAAAACAGCACAATAGCTGCTAGGTTCTTAAATAATGATTCGTGTGGAACAACAGCAAATTCAGGAAAAGATTCCAAAAT

CCCTCATTGTCCTGAATTTGCTACGGATTTACCCTCTCTTCAAAGTGATCCCAGAGTGGATACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAACTAAA

GCTGAGAGTCTCTGCACTGGTACAGGTGACAAGACATTGCCATTTCTGCACAATATTAAAATCAAAGTAGAAGACAGTAGTGCTAATGAAGAATATGAAC

CTGAGCTTATTACAAATAAGCTAAAGTGGGAGTGCAATGATGCCGAGGGTGAGTTTTACAATATGACTGAGAAGAAGGAGGAGGACGCCTTGGTACCCAC

AGCCAAGGAAGGTTTTGCATGCCCTGAGAAAGAAACGCCTTCCTTAAATCCACTGGCTCAGAGTCAGGGCCTCTCATGCACTTTAGGATCTCCAAAACCT

GAGGATGGGGAATATAAATTTGGTGCCAGGGTGAGAAAAAATTACCGGACACTAGTACTGGGCAAACGACCAGTCCTTCAGACACCTCCAGTCAAACCAA

ATTTGAAATCAGCTAGAAGCCCTCGTCCTACAGGTAAAACTGAGACACATGAAGGAACACTGGATGACTTTACAGTTTTAAACAGACGCAAAAAGGTAGC

CAGCAATGTAGCATCAGCAGTGAAAAGGCCATTTAATTTCATGGCAAATTTTCCTTGTCCACCTTCACTCATTATTGGGAAGGATGGGGATTTGTGGCCA

GCGTATTCCTTAAACACCACTAAGGATTCCCAACCTCCTCACAAGGCCCATCCTATATGGAAATGGCAGCTGGGCGGTTCTGCAATACCTCTTCCACCTA

GTCACAAATTCAGGAAATTTAATTCATAAAAAAATGTTTTGGAAGATATTTTCTCGAACCATATTACCTTCCTTTTGTTGTAAACTGCACAGGATGGCTT

GTACCAAGTCCATTAATGGTGTTACACCCCTTTTGGAGTCCTGGTTTATCGCATTTTGAAGACAAAAATCGGATTACTTTTTTTTCCCATTGCGGGTTGT

TTTTTTTTTTTTTTTATGGTGGGGGAGGGGTGGGAGAAGGGTTGGTTTACATACCACAGACTACTTCAGGCTAAAGACTCAAGTAACACTCAGTTATTAT

GGTAGAGCTGGAACACTTTACTGTTTCAATGGTAATAATGCACCGGTACCTCAATTCAACTGCTACAAATAAATGTCAAAAGGTTGAATAATAAATATCA

CAATGAGCCATTAAGTTTATGCACTAGATTTCAGACCTGAAAGTGTAACTGGTATTCAGTGAAAGTTTGTTAGGTTACATGGTTACACAATGAGGTAGCA

AGAAGTTTCTGTGAGCCCAAATGTAATTTTCTGGAGCTCTTATTTGTGGGGTGTCTTTTTTATTTTTTTTCTAAACCCAGATTCCCTTTCCAATAGTAGT

TGCACTTAACTGTTTTTTTGTTTTGTTTTGTTTTGTTTTTTAATGGAAAGATTGGGGGTCTGAGTCCTGATTGGATGCTGATTTAAAAGCTGCCCATTGT

GTGAGAAGTAAAAAAATACTTTTTTTTTTTTAACCTTTACAGTCACTCCTTGCAACTGGAAAAGCCCCTTCTGCGCTCTCACCCAAACATTTAAAATAGG

ATGACTCTTGCTGTGCTCCTGCTTGTCTTCTGATCTGAAGATAACTCTTCAAGCTTTCAAAACAATTAAAACATTTCTCTTAATAGCAGGATGTTTAATG

GTCTAACTCATCCTAGTGTCCAAGCAGTAAATACAACCAAGAAAAAGAGTCATAACACCCCAAGTGAAAAATAACTGATTTCAGGGCTTTTTGGTATTAG

AACTCAGGCACTTGGATTTTATTACCTTATGCTTTTTTTTTTCTGCATCTCTCTAAACTTCTGTTTCAGGCCATCCTGTGTATAGAACAGGAGAGTTTCT

ACTGCAAGTGACAATCAGAGGTGACTATCTATATTTGCACTTAAAATCAAAGTAGTTCCACAGGCAAGTGGTCTAGCCCTTGGTGAGGCCATGCTGGTGG

ACTGTGTTGTAAAGATGAGAGCAGTAAATCAAAATTATGGAAATTTGCACTGTTGAAAAGCATGCTTTAGCTTTATTTTCAATTAAAAACACTGTTTAAA

ATTCCTGGTTCCATACATTTCTACTTATTCCAGATTGAAGAAGGGTTAACAAGAATGAATGGCTTTGTTGACATTTTCACTTGTAATGTTTTTGCCTGAA

AGAAATGCATTTATTGGGTGCAGTGTTTTGTGGTAATACTTTGTGATGAGACCAATCAGGTTCTGGGCACAACACTGGCAAACTTCCTCTCAAATAACAG

AAAAACTTTTCAAACTTGTTATAGGCCAACTATTAAAAAGTTTCATATCTAAGAAA
Translation
 - UNI32079 - MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISRE

DVEALYTSCKTERVLKTKRRRVGRALATKAPPPERAAAASPRPAFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVR

SPCKSSLNYETAQLQGNYVAFHSDPAYFRSLLCSKHPA - UNI32079 - - UNI33165 - AAAGATCLERFHLVNSFCPPPHHHHHHHHHHHHHH

HRAQQPTPSHHPSHHHRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEEEGEEEEEEEEEEEGGSGASDSSEISSEEEDSSTE

SDSSSGSSQVSVQSIRFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPEEWSLQSWAPKGTPVYCPASLGSCFPEIRNDR

VSEITFPHSEISSTVKRTDLTINCHAEGASSPSPKTNNVFPQQRILREARKCLQATPTTHCAENSTIAARFLNNDSCGTTANSGKDSKIPHCPEFATDLP

SLQSDPRVDTATAAAAAAAATKAESLCTGTGDKTLPFLHNIKIKVEDSSANEEYEPELITNKLKWECNDAEGEFYNMTEKKEEDALVPTAKEGFACPEKE

TPSLNPLAQSQGLSCTLGSPKPEDGEYKFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETHEGTLDDFTVLNRRKKVASNVASAVKRPF

NFMANFPCPPSLIIGKDGDLWPAYSLNTTKDSQPPHKAHPIWKWQLGGSAIPLPPSHKFRKFNS
Transcript ENSMUST00000066885
Sequence
ATGGGAGACCTGAAGTCAGGTTTCGAAGAGGTGGATGGCGTGAGGCTCGGCTACCTCATCATTAAAGGGAAGCAAATGTTTGCTCTCTCCCAAGTCTTCA

CAGATCTGCTGAAAAACATCCCGAGGACGACCGTGCACAAGCGCATGGATCATCTGAAAGTGAAAAAGCACCACTGCGATCTGGAGGAGTTGCGGAAACT

CAAAGCAATCAACAGTATCGCCTTCCACGCGGCCAAATGCACGCTCATCTCCCGGGAAGACGTAGAAGCGCTCTACACATCCTGCAAAACCGAGCGTGTG

CTCAAGACCAAGCGAAGGAGAGTCGGTCGGGCCCTGGCCACAAAGGCGCCGCCGCCAGAGCGCGCCGCCGCCGCCAGCCCCCGCCCGGCTTTTTGGAAGG

ACAAGCACCAACTTTGGCGGGGCCTGAGCGGAGCCGCGCGGCCCCTGCCAATCAGCGCGCAGTCCCAGCGTCCGGGCGCCGCCGCCGCGCGCCCCGCCGC

CCATCTACCTCAGATTTTTAGCAAATACCCGGGCTCCCACTACCCGGAGATCGTTCGCTCGCCTTGCAAATCCTCTTTAAACTATGAAACTGCCCAGCTC

CAGGGAAACTACGTCGCCTTCCACTCGGACCCCGCTTATTTTCGGAGCCTGCTGTGCAGCAAGCACCCG - UNI32079 - - UNI33165 - GCGG

CGGCCGGGGCCACTTGCTTGGAGAGGTTTCATCTGGTCAACAGCTTCTGCCCGCCTCCCCACCACCACCATCACCATCACCACCATCATCATCACCATCA

CCACCGAGCCCAGCAGCCAACGCCGAGTCACCACCCCTCTCATCACCACCGGCCGCAACCCCATCTAGGAAGCTTTCCCGAGAGTTGTAGCAGCGACTCC

GAGTCCAGCTCCTACTCCGACCATGCAGCCAATGACTCGGATTTTGGCTCCAGTTTGTCCAGCTCCAGCAACTCGGTGTCCTCAGAGGAAGAGGAGGAGG

AAGGAGAGGAGGAGGAGGAAGAGGAGGAGGAGGAAGAGGGGGGCAGCGGGGCCTCGGATTCCAGTGAAATCAGCTCGGAGGAGGAGGATTCTTCCACCGA

GTCAGACTCCAGCTCCGGGTCCAGCCAAGTGTCAGTGCAGAGCATCCGTTTCAGGCGCACCAGCTTCTGCAAGCCTCCCAGCGTGCAGGCGCAGGCCAAC

TTCTTGTACCATCTGGCCTCCGCCGCCGCTGCAACCAAACCCGCTGCTTTCGAGGATGCCGGCCGACTTCCCGACCTCAAGAGTAGTGTCAAAGCCGAGT

CACCAGAGGAGTGGAGTCTGCAGAGCTGGGCTCCCAAAGGGACTCCGGTGTACTGCCCGGCCAGCTTGGGGAGTTGTTTCCCAGAGATAAGAAACGATAG

GGTATCTGAGATTACATTCCCACACTCTGAAATATCCAGTACTGTAAAGAGAACTGACCTGACAATTAACTGCCATGCAGAGGGGGCCTCTTCACCTAGC

CCAAAGACAAACAATGTATTTCCACAACAAAGAATACTCCGAGAGGCTAGGAAATGCCTACAAGCAACTCCTACTACACACTGTGCAGAAAACAGCACAA

TAGCTGCTAGGTTCTTAAATAATGATTCGTGTGGAACAACAGCAAATTCAGGAAAAGATTCCAAAATCCCTCATTGTCCTGAATTTGCTACGGATTTACC

CTCTCTTCAAAGTGATCCCAGAGTGGATACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAACTAAAGCTGAGAGTCTCTGCACTGGTACAGGTGACAAG

ACATTGCCATTTCTGCACAATATTAAAATCAAAGTAGAAGACAGTAGTGCTAATGAAGAATATGAACCTGAGCTTATTACAAATAAGCTAAAGTGGGAGT

GCAATGATGCCGAGGGTGAGTTTTACAATATGACTGAGAAGAAGGAGGAGGACGCCTTGGTACCCACAGCCAAGGAAGGTTTTGCATGCCCTGAGAAAGA

AACGCCTTCCTTAAATCCACTGGCTCAGAGTCAGGGCCTCTCATGCACTTTAGGATCTCCAAAACCTGAGGATGGGGAATATAAATTTGGTGCCAGGGTG

AGAAAAAATTACCGGACACTAGTACTGGGCAAACGACCAGTCCTTCAGACACCTCCAGTCAAACCAAATTTGAAATCAGCTAGAAGCCCTCGTCCTACAG

GTAAAACTGAGACACATGAAGGAACACTGGATGACTTTACAGTTTTAAACAGACGCAAAAAGGTAGCCAGCAATGTAGCATCAGCAGTGAAAAGGCCATT

TAATTTCATGGCAAATTTTCCTTGTCCACCTTCACTCATTATTGGGAAGGATGGGGATTTGTGGCCAGCGTATTCCTTAAACACCACTAAGGATTCCCAA

CCTCCTCACAAGGCCCATCCTATATGGAAATGGCAGCTGGGCGGTTCTGCAATACCTCTTCCACCTAGTCACAAATTCAGGAAATTTAATTCATAA
Translation
MGDLKSGFEEVDGVRLGYLIIKGKQMFALSQVFTDLLKNIPRTTVHKRMDHLKVKKHHCDLEELRKLKAINSIAFHAAKCTLISREDVEALYTSCKTERV

LKTKRRRVGRALATKAPPPERAAAASPRPAFWKDKHQLWRGLSGAARPLPISAQSQRPGAAAARPAAHLPQIFSKYPGSHYPEIVRSPCKSSLNYETAQL

QGNYVAFHSDPAYFRSLLCSKHP - UNI32079 - - UNI33165 - AAAGATCLERFHLVNSFCPPPHHHHHHHHHHHHHHHRAQQPTPSHHPSHH

HRPQPHLGSFPESCSSDSESSSYSDHAANDSDFGSSLSSSSNSVSSEEEEEEGEEEEEEEEEEEGGSGASDSSEISSEEEDSSTESDSSSGSSQVSVQSI

RFRRTSFCKPPSVQAQANFLYHLASAAAATKPAAFEDAGRLPDLKSSVKAESPEEWSLQSWAPKGTPVYCPASLGSCFPEIRNDRVSEITFPHSEISSTV

KRTDLTINCHAEGASSPSPKTNNVFPQQRILREARKCLQATPTTHCAENSTIAARFLNNDSCGTTANSGKDSKIPHCPEFATDLPSLQSDPRVDTATAAA

AAAAATKAESLCTGTGDKTLPFLHNIKIKVEDSSANEEYEPELITNKLKWECNDAEGEFYNMTEKKEEDALVPTAKEGFACPEKETPSLNPLAQSQGLSC

TLGSPKPEDGEYKFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETHEGTLDDFTVLNRRKKVASNVASAVKRPFNFMANFPCPPSLIIG

KDGDLWPAYSLNTTKDSQPPHKAHPIWKWQLGGSAIPLPPSHKFRKFNS

For any suggestions or comments, please send an email to unitrap@crg.es