Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054102 (Nlrp9a)
Chromosomal location
Chr 7: 27320084 - 27360634 (+)
Description
NLR family, pyrin domain containing 9A Gene [Source:MGI (curated);Acc:Nlrp9a-003]
RefSeq_dna
NM_001048220 NM_001048219 
RefSeq_peptide
NP_001041685.1 NP_001041684.1 
UniGene
Mm.11889 
MGI
MGI:2675292 
Uniprot/SWISSPROT
Q66X03 
Human Ortholog
ENSG00000185792 (NLRP9)
Omim not available
UniTrap UNI24392
Vector Insertion
Chr 7: 27353023 - 27355525
Public Clones not available
Private Clones OST222361 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000122040
Sequence
ATGATGGACTCATCTGGGTATGGCTTGCTGCAGTATTTGCAAAAGCTCAGTGATGAAGAGTTCCAGAGATTTAAAGAACATCTCAGGAAAGAGCCAGAGA

AATTTAAACTTAAACCTATCTCCTGGACTAAGATCAAAAACACTTCCAAAGAAGACCTGGTAATGCAATTGTACACACATTATCCAGGAAAGGCATGGGA

TATGGTGTTGAGCCTGTTTCTACAGGTCAATCGGGAAGACCTCTCAACCATGGCTCAGACAGAAAGGAGAG ATAAACAAACTAAATACAAAGAGTTTAT

GAAGAATACATTTCAGCACATATGGACAATGGAGACCAACACTTATATACCTGATAGAAGCTACCACGAATTTATAGAAGTCCAGTACAGAGCATTGCAG

GACATATTTGATTGTGAGTCAGAGCCAGTCACTGTAGTTGTATCAGGTTCTAGAGGAGGAGGTAAAACTACTTTCTTAAGAAAAGCAATGTTGGATTGGG

CATCAAGAAATTTACTGCAGAACCGATTTCAATATGTTTTCTACTTCTCCGTCTTCTCACTTAACAATATCACAGAGTTAAGCTTAGCTGAGCTTATCTC

AAGTACGTTGCCTGAATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTGTTTATCCTGGATGGATTTGATTACCTGAAATTTGAC

TTGGAACTCAGGACAAACCTGTGCAATGACTGGAGGAAGAAGCTGCCAATACAAATTGTCTTGAGTAGTTTGCTACAGAAAATAATGCTCCCAGAATGTT

CTCTGCTCCTTGAATTGGGAAATGCAAGTCTTTCAAACATTATTCCTTTGCTGCAATATCCAAGGGAGATAATTATGTCAGGATTCTCTGAACAAACTAT

AGAAATCTACTGTGTGTCTTTCTTTAATACCCAGACAGGTGTAGAAATCTTTAAGAATTTAAAGAGCATTAAACCATTGTTCAATTTATGCCGCTGTCCT

CATCTATGCTGGATGATCTGTAGTACTATAAAGTGGCAGTATGAGAGGAGAGAGGTAGCAAGTCGTTTTGGTCGAACATTAGGACTCCTCTACACAATAT

TTATGGTTAGCGCATTTAAATCAACATATGCCAGGAATCCATCTAAACAGAACAGGGCCCGTATAAGGACCCTATGCACCTTGGCTGTAGAGGGAATGTG

GAAACAGGTATATGTGTTTGACTCTGATGACCTCAGGAGGAATGGGATATCTGAATCAGATAAGAAAGTGTGGCTGAGAATGAAATTTCTCCAGAATCAA

GGTAGCAACATTGTATTTTATCATTCTACACTACAGTGGTACTTTGCTGTGCTGTTCTATTTTCTCCAATACAAAGACACACGTCACCCAGTTATTGGAA

ACCTCGCTCAACTCCTAGGAGAAATCTATGCTCATAAACAGAACCAATGGTTCCACACACGGATATTATTGTTTGGAATGGCCACTGAGCAAGTTAACTC

CTTGCTTGAACCATGCTTTGGCTGTATATCATCCAAGGAGGTAAGACAGGAAATCATCAGATACATCAAAAGTCTCAGTCAACAAGAATGCAATGAAAAA

CTGGTGGTGCATCCCCAGAATTTGTTTTTCTGTATACTTGACAACCAGGAGGAAAGATTTGTAAGACAATTGATGGATCGATTTGAAGAAATGACTGTTG

ATATTAGTGATGTTGATGATATGTCAGCAACTCCATATTGTCTGCATAGAGCCCCAAAAGTGAAAAACCTTCACCTGCATATACAAAAGAGAGTTTTTTT

AGAAATCCATGATCCAGAATATGGTGACTTAGAACTCTTTAAACTCGACCAAAA GTGTTCCTTCACGACTAACTTTGGAGATGGTTTATTATTTTGCAC

ATTTCTTCACCTACCTCACCTGAAATACATGAACCTGTATGGCACTAATCTCTCTAATGATGCAGTTGAGAGGCTGTGCTCAGCTCTGAAATTTTCAACA

TGTGGAGTGGAGGAGCTGTT GTTGGGAAAATGTGACATATCAAGTGAGGCTTGTGGCATAATTGCAGCTTCCCTTATCAATTCTGAGGTGAAACATCTC

TCATTGGTTGAAAATCCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGGAATCACTGAT GTTGTCTTAC

TGCTGTCTCACATTCATTGCCTGTGGACATCTCTATGAAGCTCTTTTGAGCAATGAACACCTCTCTCTGCTTGATCTGGGGTCAAATTTCCTGGAAGACA

CTGGAGTGAACCTTCTGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG - UNI24392 - GTTGCCTGGTTGCTATTTAACTTCA

GAATGTTGTGAAGAGATCTCGGCTGTCCTGACTTGCAATACAAATCTAAAGACCCTGAAACTTGGCAACAATAACATACAAGACACTGGTGTCAAACGGT

TATGTGAAGCTCTGTGTCATCCTAACTGTGAAATGCAGTGTCTTGG GTTAGACATGTGTGACTTCACCAGTGACTGTTGTGAAGACCTGGCCTTGGTTC

TTACCACCTGCAACACATTGAAGAGCTTAAACCTTGACTGGAATGCCTTTGACCATTCTGGGCTGGAGATGCTCTGTAAGGCCTTGAATCACAAAGCCTG

TAACCTGGAGGTGCTTGG ACTGGACAAATCTTTATTTTCTGAGGAATCACAGACATTACTGCAAGCTGTGGAAAAGAAAAATAAAAATCTGAAAGTTTT

GCATTTTCCCTGGCTTAAAGAGGAACTCGAAAAGAGGGGTGTTCGTCTGGTATGGAACAGCAAGAATTGA
Translation
MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTHYPGKAWDMVLSLFLQVNREDLSTMAQTERRD DKQTKYKE

FMKNTFQHIWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAEL

ISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSEQ

TIEIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVEG

MWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQV

NSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKRV

FLEIHDPEYGDLELFKLDQK KCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCSALKFSTCGVEELL LLGKCDISSEACGIIAASLINS

EVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLM MLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW - UNI

24392 - WLPGCYLTSECCEEISAVLTCNTNLKTLKLGNNNIQDTGVKRLCEALCHPNCEMQCLG GLDMCDFTSDCCEDLALVLTTCNTLKSLNLDWN

AFDHSGLEMLCKALNHKACNLEVLG GLDKSLFSEESQTLLQAVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN
Transcript ENSMUST00000071780
Sequence
GTGGCCCTTCAATAAGTACTAGCCCATGGGACCAGGTCTGGAATGG ATTTATCAACCTCTAGATTCTGAGGTCACTGTCCCAAGATGATGGACTCATCT

GGGTATGGCTTGCTGCAGTATTTGCAAAAGCTCAGTGATGAAGAGTTCCAGAGATTTAAAGAACATCTCAGGAAAGAGCCAGAGAAATTTAAACTTAAAC

CTATCTCCTGGACTAAGATCAAAAACACTTCCAAAGAAGACCTGGTAATGCAATTGTACACACATTATCCAGGAAAGGCATGGGATATGGTGTTGAGCCT

GTTTCTACAGGTCAATCGGGAAGACCTCTCAACCATGGCTCAGACAGAAAGGAGAG ATAAACAAACTAAATACAAAGAGTTTATGAAGAATACATTTCA

GCACATATGGACAATGGAGACCAACACTTATATACCTGATAGAAGCTACCACGAATTTATAGAAGTCCAGTACAGAGCATTGCAGGACATATTTGATTGT

GAGTCAGAGCCAGTCACTGTAGTTGTATCAGGTTCTAGAGGAGGAGGTAAAACTACTTTCTTAAGAAAAGCAATGTTGGATTGGGCATCAAGAAATTTAC

TGCAGAACCGATTTCAATATGTTTTCTACTTCTCCGTCTTCTCACTTAACAATATCACAGAGTTAAGCTTAGCTGAGCTTATCTCAAGTACGTTGCCTGA

ATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTGTTTATCCTGGATGGATTTGATTACCTGAAATTTGACTTGGAACTCAGGACA

AACCTGTGCAATGACTGGAGGAAGAAGCTGCCAATACAAATTGTCTTGAGTAGTTTGCTACAGAAAATAATGCTCCCAGAATGTTCTCTGCTCCTTGAAT

TGGGAAATGCAAGTCTTTCAAACATTATTCCTTTGCTGCAATATCCAAGGGAGATAATTATGTCAGGATTCTCTGAACAAACTATAGAAATCTACTGTGT

GTCTTTCTTTAATACCCAGACAGGTGTAGAAATCTTTAAGAATTTAAAGAGCATTAAACCATTGTTCAATTTATGCCGCTGTCCTCATCTATGCTGGATG

ATCTGTAGTACTATAAAGTGGCAGTATGAGAGGAGAGAGGTAGCAAGTCGTTTTGGTCGAACATTAGGACTCCTCTACACAATATTTATGGTTAGCGCAT

TTAAATCAACATATGCCAGGAATCCATCTAAACAGAACAGGGCCCGTATAAGGACCCTATGCACCTTGGCTGTAGAGGGAATGTGGAAACAGGTATATGT

GTTTGACTCTGATGACCTCAGGAGGAATGGGATATCTGAATCAGATAAGAAAGTGTGGCTGAGAATGAAATTTCTCCAGAATCAAGGTAGCAACATTGTA

TTTTATCATTCTACACTACAGTGGTACTTTGCTGTGCTGTTCTATTTTCTCCAATACAAAGACACACGTCACCCAGTTATTGGAAACCTCGCTCAACTCC

TAGGAGAAATCTATGCTCATAAACAGAACCAATGGTTCCACACACGGATATTATTGTTTGGAATGGCCACTGAGCAAGTTAACTCCTTGCTTGAACCATG

CTTTGGCTGTATATCATCCAAGGAGGTAAGACAGGAAATCATCAGATACATCAAAAGTCTCAGTCAACAAGAATGCAATGAAAAACTGGTGGTGCATCCC

CAGAATTTGTTTTTCTGTATACTTGACAACCAGGAGGAAAGATTTGTAAGACAATTGATGGATCGATTTGAAGAAATGACTGTTGATATTAGTGATGTTG

ATGATATGTCAGCAACTCCATATTGTCTGCATAGAGCCCCAAAAGTGAAAAACCTTCACCTGCATATACAAAAGAGAGTTTTTTTAGAAATCCATGATCC

AGAATATGGTGACTTAGAACTCTTTAAACTCGACCAAAA GTGTTCCTTCACGACTAACTTTGGAGATGGTTTATTATTTTGCACATTTCTTCACCTACC

TCACCTGAAATACATGAACCTGTATGGCACTAATCTCTCTAATGATGCAGTTGAGAGGCTGTGCTCAGCTCTGAAATTTTCAACATGTGGAGTGGAGGAG

CTGTT GTTGGGAAAATGTGACATATCAAGTGAGGCTTGTGGCATAATTGCAGCTTCCCTTATCAATTCTGAGGTGAAACATCTCTCATTGGTTGAAAAT

CCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGGAATCACTGAT GTTGTCTTACTGCTGTCTCACATTC

ATTGCCTGTGGACATCTCTATGAAGCTCTTTTGAGCAATGAACACCTCTCTCTGCTTGATCTGGGGTCAAATTTCCTGGAAGACACTGGAGTGAACCTTC

TGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG - UNI24392 - GTTGCCTGGTTGCTATTTAACTTCAGAATGTTGTGAAGAG

ATCTCGGCTGTCCTGACTTGCAATACAAATCTAAAGACCCTGAAACTTGGCAACAATAACATACAAGACACTGGTGTCAAACGGTTATGTGAAGCTCTGT

GTCATCCTAACTGTGAAATGCAGTGTCTTGG GTTAGACATGTGTGACTTCACCAGTGACTGTTGTGAAGACCTGGCCTTGGTTCTTACCACCTGCAACA

CATTGAAGAGCTTAAACCTTGACTGGAATGCCTTTGACCATTCTGGGCTGGAGATGCTCTGTAAGGCCTTGAATCACAAAGCCTGTAACCTGGAGGTGCT

TGG ACTGGACAAATCTTTATTTTCTGAGGAATCACAGACATTACTGCAAGCTGTGGAAAAGAAAAATAAAAATCTGAAAGTTTTGCATTTTCCCTGGCT

TAAAGAGGAACTCGAAAAGAGGGGTGTTCGTCTGGTATGGAACAGCAAGAATTGATCTGTAACAAAGGTTTATCCTTTTTTATGTTTCTCCTATATACCC

TGTCCCAAGTTGCACACCATGGTACTGGTGGCTGTCGCCAGAGCTGTTCTTCCACATTGTTCCACCCCCACCTTTCTTTATATCTCCCCTCACCACTTTG

CAATGTTTATACTACAAGCACATTCAATAAACACTAAGCATGTGTG
Translation
 MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTHYPGKAWDMVLSLFLQVNREDLSTMAQTERRD DKQTKYK

EFMKNTFQHIWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAE

LISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSE

QTIEIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVE

GMWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQ

VNSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKR

VFLEIHDPEYGDLELFKLDQK KCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCSALKFSTCGVEELL LLGKCDISSEACGIIAASLIN

SEVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLM MLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW - UN

I24392 - WLPGCYLTSECCEEISAVLTCNTNLKTLKLGNNNIQDTGVKRLCEALCHPNCEMQCLG GLDMCDFTSDCCEDLALVLTTCNTLKSLNLDW

NAFDHSGLEMLCKALNHKACNLEVLG GLDKSLFSEESQTLLQAVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN
Transcript ENSMUST00000108387
Sequence
GTGGCCCTTCAATAAGTACTAGCCCATGGGACCAGGTCTGGAATGG ATTTATCAACCTCTAGATTCTGAGGTCACTGTCCCAAGATGATGGACTCATCT

GGGTATGGCTTGCTGCAGTATTTGCAAAAGCTCAGTGATGAAGAGTTCCAGAGATTTAAAGAACATCTCAGGAAAGAGCCAGAGAAATTTAAACTTAAAC

CTATCTCCTGGACTAAGATCAAAAACACTTCCAAAGAAGACCTGGTAATGCAATTGTACACACATTATCCAGGAAAGGCATGGGATATGGTGTTGAGCCT

GTTTCTACAGGTCAATCGGGAAGACCTCTCAACCATGGCTCAGACAGAAAGGAGAG ATAAACAAACTAAATACAAAGAGTTTATGAAGAATACATTTCA

GCACATATGGACAATGGAGACCAACACTTATATACCTGATAGAAGCTACCACGAATTTATAGAAGTCCAGTACAGAGCATTGCAGGACATATTTGATTGT

GAGTCAGAGCCAGTCACTGTAGTTGTATCAGGTTCTAGAGGAGGAGGTAAAACTACTTTCTTAAGAAAAGCAATGTTGGATTGGGCATCAAGAAATTTAC

TGCAGAACCGATTTCAATATGTTTTCTACTTCTCCGTCTTCTCACTTAACAATATCACAGAGTTAAGCTTAGCTGAGCTTATCTCAAGTACGTTGCCTGA

ATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTGTTTATCCTGGATGGATTTGATTACCTGAAATTTGACTTGGAACTCAGGACA

AACCTGTGCAATGACTGGAGGAAGAAGCTGCCAATACAAATTGTCTTGAGTAGTTTGCTACAGAAAATAATGCTCCCAGAATGTTCTCTGCTCCTTGAAT

TGGGAAATGCAAGTCTTTCAAACATTATTCCTTTGCTGCAATATCCAAGGGAGATAATTATGTCAGGATTCTCTGAACAAACTATAGAAATCTACTGTGT

GTCTTTCTTTAATACCCAGACAGGTGTAGAAATCTTTAAGAATTTAAAGAGCATTAAACCATTGTTCAATTTATGCCGCTGTCCTCATCTATGCTGGATG

ATCTGTAGTACTATAAAGTGGCAGTATGAGAGGAGAGAGGTAGCAAGTCGTTTTGGTCGAACATTAGGACTCCTCTACACAATATTTATGGTTAGCGCAT

TTAAATCAACATATGCCAGGAATCCATCTAAACAGAACAGGGCCCGTATAAGGACCCTATGCACCTTGGCTGTAGAGGGAATGTGGAAACAGGTATATGT

GTTTGACTCTGATGACCTCAGGAGGAATGGGATATCTGAATCAGATAAGAAAGTGTGGCTGAGAATGAAATTTCTCCAGAATCAAGGTAGCAACATTGTA

TTTTATCATTCTACACTACAGTGGTACTTTGCTGTGCTGTTCTATTTTCTCCAATACAAAGACACACGTCACCCAGTTATTGGAAACCTCGCTCAACTCC

TAGGAGAAATCTATGCTCATAAACAGAACCAATGGTTCCACACACGGATATTATTGTTTGGAATGGCCACTGAGCAAGTTAACTCCTTGCTTGAACCATG

CTTTGGCTGTATATCATCCAAGGAGGTAAGACAGGAAATCATCAGATACATCAAAAGTCTCAGTCAACAAGAATGCAATGAAAAACTGGTGGTGCATCCC

CAGAATTTGTTTTTCTGTATACTTGACAACCAGGAGGAAAGATTTGTAAGACAATTGATGGATCGATTTGAAGAAATGACTGTTGATATTAGTGATGTTG

ATGATATGTCAGCAACTCCATATTGTCTGCATAGAGCCCCAAAAGTGAAAAACCTTCACCTGCATATACAAAAGAGAGTTTTTTTAGAAATCCATGATCC

AGAATATGGTGACTTAGAACTCTTTAAACTCGACCAAAA ACTTTTAGCCAAGCATTGGACTACGTTATGCACTTTTCTCTGTAACTTACATGTGTTGGA

TCTGGACAGCTGTCATTTCAATGAAAAAGCCATAGAGGTTCTCTGTAATTGTTTGCCTCTAACTTCTTTAGTACCTCTGACTGGTTTTAAGCTCCACAGA

TTGTT GTGTTCCTTCACGACTAACTTTGGAGATGGTTTATTATTTTGCACATTTCTTCACCTACCTCACCTGAAATACATGAACCTGTATGGCACTAAT

CTCTCTAATGATGCAGTTGAGAGGCTGTGCTCAGCTCTGAAATTTTCAACATGTGGAGTGGAGGAGCTGTT GTTGGGAAAATGTGACATATCAAGTGAG

GCTTGTGGCATAATTGCAGCTTCCCTTATCAATTCTGAGGTGAAACATCTCTCATTGGTTGAAAATCCCTTGAAGAACAAAGGAGTGATGTCACTGTGTG

AAATGCTGAAGGATCCAAGCTGTGTCCTGGAATCACTGAT GTTGTCTTACTGCTGTCTCACATTCATTGCCTGTGGACATCTCTATGAAGCTCTTTTGA

GCAATGAACACCTCTCTCTGCTTGATCTGGGGTCAAATTTCCTGGAAGACACTGGAGTGAACCTTCTGTGTGAAGCTTTGAAAGATCCAAACTGCACCCT

CAAGGAGTTATG - UNI24392 - GTTGCCTGGTTGCTATTTAACTTCAGAATGTTGTGAAGAGATCTCGGCTGTCCTGACTTGCAATACAAATCTAA

AGACCCTGAAACTTGGCAACAATAACATACAAGACACTGGTGTCAAACGGTTATGTGAAGCTCTGTGTCATCCTAACTGTGAAATGCAGTGTCTTGG GT

TAGACATGTGTGACTTCACCAGTGACTGTTGTGAAGACCTGGCCTTGGTTCTTACCACCTGCAACACATTGAAGAGCTTAAACCTTGACTGGAATGCCTT

TGACCATTCTGGGCTGGAGATGCTCTGTAAGGCCTTGAATCACAAAGCCTGTAACCTGGAGGTGCTTGG ACTGGACAAATCTTTATTTTCTGAGGAATC

ACAGACATTACTGCAAGCTGTGGAAAAGAAAAATAAAAATCTGAAAGTTTTGCATTTTCCCTGGCTTAAAGAGGAACTCGAAAAGAGGGGTGTTCGTCTG

GTATGGAACAGCAAGAATTGATCTGTAACAAAGGTTTATCCTTTTTTATGTTTCTCCTATATACCCTGTCCCAAGTTGCACACCATGGTACTGGTGGCTG

TCGCCAGAGCTGTTCTTCCACATTGTTCCACCCCCACCTTTCTTTATATCTCCCCTCACCACTTTGCAATGTTTATACTACAAGCACATTCAATAAACAC

TAAGCATGTGTG
Translation
 MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTHYPGKAWDMVLSLFLQVNREDLSTMAQTERRD DKQTKYK

EFMKNTFQHIWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAE

LISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSE

QTIEIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVE

GMWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQ

VNSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKR

VFLEIHDPEYGDLELFKLDQK KLLAKHWTTLCTFLCNLHVLDLDSCHFNEKAIEVLCNCLPLTSLVPLTGFKLHRLL LCSFTTNFGDGLLFCTFLHLP

HLKYMNLYGTNLSNDAVERLCSALKFSTCGVEELL LLGKCDISSEACGIIAASLINSEVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLM MLSYCC

LTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW - UNI24392 - WLPGCYLTSECCEEISAVLTCNTNLKTLKLGNNN

IQDTGVKRLCEALCHPNCEMQCLG GLDMCDFTSDCCEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLG GLDKSLFSEESQTLLQ

AVEKKNKNLKVLHFPWLKEELEKRGVRLVWNSKN
Transcript ENSMUST00000117252
Sequence
ATGATGGACTCATCTGGGTATGGCTTGCTGCAGTATTTGCAAAAGCTCAGTGATGAAGAGTTCCAGAGATTTAAAGAACATCTCAGGAAAGAGCCAGAGA

AATTTAAACTTAAACCTATCTCCTGGACTAAGATCAAAAACACTTCCAAAGAAGACCTGGTAATGCAATTGTACACACATTATCCAGGAAAGGCATGGGA

TATGGTGTTGAGCCTGTTTCTACAGGTCAATCGGGAAGACCTCTCAACCATGGCTCAGACAGAAAGGAGAG ATAAACAAACTAAATACAAAGAGTTTAT

GAAGAATACATTTCAGCACATATGGACAATGGAGACCAACACTTATATACCTGATAGAAGCTACCACGAATTTATAGAAGTCCAGTACAGAGCATTGCAG

GACATATTTGATTGTGAGTCAGAGCCAGTCACTGTAGTTGTATCAGGTTCTAGAGGAGGAGGTAAAACTACTTTCTTAAGAAAAGCAATGTTGGATTGGG

CATCAAGAAATTTACTGCAGAACCGATTTCAATATGTTTTCTACTTCTCCGTCTTCTCACTTAACAATATCACAGAGTTAAGCTTAGCTGAGCTTATCTC

AAGTACGTTGCCTGAATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTGTTTATCCTGGATGGATTTGATTACCTGAAATTTGAC

TTGGAACTCAGGACAAACCTGTGCAATGACTGGAGGAAGAAGCTGCCAATACAAATTGTCTTGAGTAGTTTGCTACAGAAAATAATGCTCCCAGAATGTT

CTCTGCTCCTTGAATTGGGAAATGCAAGTCTTTCAAACATTATTCCTTTGCTGCAATATCCAAGGGAGATAATTATGTCAGGATTCTCTGAACAAACTAT

AGAAATCTACTGTGTGTCTTTCTTTAATACCCAGACAGGTGTAGAAATCTTTAAGAATTTAAAGAGCATTAAACCATTGTTCAATTTATGCCGCTGTCCT

CATCTATGCTGGATGATCTGTAGTACTATAAAGTGGCAGTATGAGAGGAGAGAGGTAGCAAGTCGTTTTGGTCGAACATTAGGACTCCTCTACACAATAT

TTATGGTTAGCGCATTTAAATCAACATATGCCAGGAATCCATCTAAACAGAACAGGGCCCGTATAAGGACCCTATGCACCTTGGCTGTAGAGGGAATGTG

GAAACAGGTATATGTGTTTGACTCTGATGACCTCAGGAGGAATGGGATATCTGAATCAGATAAGAAAGTGTGGCTGAGAATGAAATTTCTCCAGAATCAA

GGTAGCAACATTGTATTTTATCATTCTACACTACAGTGGTACTTTGCTGTGCTGTTCTATTTTCTCCAATACAAAGACACACGTCACCCAGTTATTGGAA

ACCTCGCTCAACTCCTAGGAGAAATCTATGCTCATAAACAGAACCAATGGTTCCACACACGGATATTATTGTTTGGAATGGCCACTGAGCAAGTTAACTC

CTTGCTTGAACCATGCTTTGGCTGTATATCATCCAAGGAGGTAAGACAGGAAATCATCAGATACATCAAAAGTCTCAGTCAACAAGAATGCAATGAAAAA

CTGGTGGTGCATCCCCAGAATTTGTTTTTCTGTATACTTGACAACCAGGAGGAAAGATTTGTAAGACAATTGATGGATCGATTTGAAGAAATGACTGTTG

ATATTAGTGATGTTGATGATATGTCAGCAACTCCATATTGTCTGCATAGAGCCCCAAAAGTGAAAAACCTTCACCTGCATATACAAAAGAGAGTTTTTTT

AGAAATCCATGATCCAGAATATGGTGACTTAGAACTCTTTAAACTCGACCAAAA GTGTTCCTTCACGACTAACTTTGGAGATGGTTTATTATTTTGCAC

ATTTCTTCACCTACCTCACCTGAAATACATGAACCTGTATGGCACTAATCTCTCTAATGATGCAGTTGAGAGGCTGTGCTCAGCTCTGAAATTTTCAACA

TGTGGAGTGGAGGAGCTGTT GTTGGGAAAATGTGACATATCAAGTGAGGCTTGTGGCATAATTGCAGCTTCCCTTATCAATTCTGAGGTGAAACATCTC

TCATTGGTTGAAAATCCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGGAATCACTGAT GTTGTCTTAC

TGCTGTCTCACATTCATTGCCTGTGGACATCTCTATGAAGCTCTTTTGAGCAATGAACACCTCTCTCTGCTTGATCTGGGGTCAAATTTCCTGGAAGACA

CTGGAGTGAACCTTCTGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG - UNI24392 - GTTAGACATGTGTGACTTCACCAGT

GACTGTTGTGAAGACCTGGCCTTGGTTCTTACCACCTGCAACACATTGAAGAGCTTAAACCTTGACTGGAATGCCTTTGACCATTCTGGGCTGGAGATGC

TCTGTAAGGCCTTGAATCACAAAGCCTGTAACCTGGAGGTGCTTGG ACTGGACAAATCTTTATTTTCTGAGGAATCACAGACATTACTGCAAGCTGTGG

AAAAGAAAAATAAAAATCTGAAAGTTTTGCATTTTCCCTGGCTTAAAGAGGAACTCGAAAAGAGGGGTGTTCGTCTG AAGCTTTTGGAGGTTGAGAGGG

CAGGCATCGGATTCCCTGGAACTGTAGTTACAGGTAATAATGAGCTGCCAG GAATGAAGTCATTGCCACCAGAGAGCACTAGATCCACTGGAGGCACAG

TAACAAGCCTTGTGTAG
Translation
MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTHYPGKAWDMVLSLFLQVNREDLSTMAQTERRD DKQTKYKE

FMKNTFQHIWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAEL

ISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSEQ

TIEIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVEG

MWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQV

NSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKRV

FLEIHDPEYGDLELFKLDQK KCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCSALKFSTCGVEELL LLGKCDISSEACGIIAASLINS

EVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLM MLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW - UNI

24392 - WLDMCDFTSDCCEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLG GLDKSLFSEESQTLLQAVEKKNKNLKVLHFPWL

KEELEKRGVRL KLLEVERAGIGFPGTVVTGNNELPG GMKSLPPESTRSTGGTVTSLV
Transcript ENSMUST00000068612
Sequence
GTGGCCCTTCAATAAGTACTAGCCCATGGGACCAGGTCTGGAATGG ATTTATCAACCTCTAGATTCTGAGGTCACTGTCCCAAGATGATGGACTCATCT

GGGTATGGCTTGCTGCAGTATTTGCAAAAGCTCAGTGATGAAGAGTTCCAGAGATTTAAAGAACATCTCAGGAAAGAGCCAGAGAAATTTAAACTTAAAC

CTATCTCCTGGACTAAGATCAAAAACACTTCCAAAGAAGACCTGGTAATGCAATTGTACACACATTATCCAGGAAAGGCATGGGATATGGTGTTGAGCCT

GTTTCTACAGGTCAATCGGGAAGACCTCTCAACCATGGCTCAGACAGAAAGGAGAG ATAAACAAACTAAATACAAAGAGTTTATGAAGAATACATTTCA

GCACATATGGACAATGGAGACCAACACTTATATACCTGATAGAAGCTACCACGAATTTATAGAAGTCCAGTACAGAGCATTGCAGGACATATTTGATTGT

GAGTCAGAGCCAGTCACTGTAGTTGTATCAGGTTCTAGAGGAGGAGGTAAAACTACTTTCTTAAGAAAAGCAATGTTGGATTGGGCATCAAGAAATTTAC

TGCAGAACCGATTTCAATATGTTTTCTACTTCTCCGTCTTCTCACTTAACAATATCACAGAGTTAAGCTTAGCTGAGCTTATCTCAAGTACGTTGCCTGA

ATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTGTTTATCCTGGATGGATTTGATTACCTGAAATTTGACTTGGAACTCAGGACA

AACCTGTGCAATGACTGGAGGAAGAAGCTGCCAATACAAATTGTCTTGAGTAGTTTGCTACAGAAAATAATGCTCCCAGAATGTTCTCTGCTCCTTGAAT

TGGGAAATGCAAGTCTTTCAAACATTATTCCTTTGCTGCAATATCCAAGGGAGATAATTATGTCAGGATTCTCTGAACAAACTATAGAAATCTACTGTGT

GTCTTTCTTTAATACCCAGACAGGTGTAGAAATCTTTAAGAATTTAAAGAGCATTAAACCATTGTTCAATTTATGCCGCTGTCCTCATCTATGCTGGATG

ATCTGTAGTACTATAAAGTGGCAGTATGAGAGGAGAGAGGTAGCAAGTCGTTTTGGTCGAACATTAGGACTCCTCTACACAATATTTATGGTTAGCGCAT

TTAAATCAACATATGCCAGGAATCCATCTAAACAGAACAGGGCCCGTATAAGGACCCTATGCACCTTGGCTGTAGAGGGAATGTGGAAACAGGTATATGT

GTTTGACTCTGATGACCTCAGGAGGAATGGGATATCTGAATCAGATAAGAAAGTGTGGCTGAGAATGAAATTTCTCCAGAATCAAGGTAGCAACATTGTA

TTTTATCATTCTACACTACAGTGGTACTTTGCTGTGCTGTTCTATTTTCTCCAATACAAAGACACACGTCACCCAGTTATTGGAAACCTCGCTCAACTCC

TAGGAGAAATCTATGCTCATAAACAGAACCAATGGTTCCACACACGGATATTATTGTTTGGAATGGCCACTGAGCAAGTTAACTCCTTGCTTGAACCATG

CTTTGGCTGTATATCATCCAAGGAGGTAAGACAGGAAATCATCAGATACATCAAAAGTCTCAGTCAACAAGAATGCAATGAAAAACTGGTGGTGCATCCC

CAGAATTTGTTTTTCTGTATACTTGACAACCAGGAGGAAAGATTTGTAAGACAATTGATGGATCGATTTGAAGAAATGACTGTTGATATTAGTGATGTTG

ATGATATGTCAGCAACTCCATATTGTCTGCATAGAGCCCCAAAAGTGAAAAACCTTCACCTGCATATACAAAAGAGAGTTTTTTTAGAAATCCATGATCC

AGAATATGGTGACTTAGAACTCTTTAAACTCGACCAAAA GTGTTCCTTCACGACTAACTTTGGAGATGGTTTATTATTTTGCACATTTCTTCACCTACC

TCACCTGAAATACATGAACCTGTATGGCACTAATCTCTCTAATGATGCAGTTGAGAGGCTGTGCTCAGCTCTGAAATTTTCAACATGTGGAGTGGAGGAG

CTGTT GTTGGGAAAATGTGACATATCAAGTGAGGCTTGTGGCATAATTGCAGCTTCCCTTATCAATTCTGAGGTGAAACATCTCTCATTGGTTGAAAAT

CCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGGAATCACTGAT GTTGTCTTACTGCTGTCTCACATTC

ATTGCCTGTGGACATCTCTATGAAGCTCTTTTGAGCAATGAACACCTCTCTCTGCTTGATCTGGGGTCAAATTTCCTGGAAGACACTGGAGTGAACCTTC

TGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG - UNI24392 - GTTAGACATGTGTGACTTCACCAGTGACTGTTGTGAAGAC

CTGGCCTTGGTTCTTACCACCTGCAACACATTGAAGAGCTTAAACCTTGACTGGAATGCCTTTGACCATTCTGGGCTGGAGATGCTCTGTAAGGCCTTGA

ATCACAAAGCCTGTAACCTGGAGGTGCTTGG ACTGGACAAATCTTTATTTTCTGAGGAATCACAGACATTACTGCAAGCTGTGGAAAAGAAAAATAAAA

ATCTGAAAGTTTTGCATTTTCCCTGGCTTAAAGAGGAACTCGAAAAGAGGGGTGTTCGTCTG AAGCTTTTGGAGGTTGAGAGGGCAGGCATCGGATTCC

CTGGAACTGTAGTTACAGGTAATAATGAGCTGCCAG GAATGAAGTCATTGCCACCAGAGAGCACTAGATCCACTGGAGGCACAGTAACAAGCCTTGTGT

AG
Translation
 MMDSSGYGLLQYLQKLSDEEFQRFKEHLRKEPEKFKLKPISWTKIKNTSKEDLVMQLYTHYPGKAWDMVLSLFLQVNREDLSTMAQTERRD DKQTKYK

EFMKNTFQHIWTMETNTYIPDRSYHEFIEVQYRALQDIFDCESEPVTVVVSGSRGGGKTTFLRKAMLDWASRNLLQNRFQYVFYFSVFSLNNITELSLAE

LISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKKLPIQIVLSSLLQKIMLPECSLLLELGNASLSNIIPLLQYPREIIMSGFSE

QTIEIYCVSFFNTQTGVEIFKNLKSIKPLFNLCRCPHLCWMICSTIKWQYERREVASRFGRTLGLLYTIFMVSAFKSTYARNPSKQNRARIRTLCTLAVE

GMWKQVYVFDSDDLRRNGISESDKKVWLRMKFLQNQGSNIVFYHSTLQWYFAVLFYFLQYKDTRHPVIGNLAQLLGEIYAHKQNQWFHTRILLFGMATEQ

VNSLLEPCFGCISSKEVRQEIIRYIKSLSQQECNEKLVVHPQNLFFCILDNQEERFVRQLMDRFEEMTVDISDVDDMSATPYCLHRAPKVKNLHLHIQKR

VFLEIHDPEYGDLELFKLDQK KCSFTTNFGDGLLFCTFLHLPHLKYMNLYGTNLSNDAVERLCSALKFSTCGVEELL LLGKCDISSEACGIIAASLIN

SEVKHLSLVENPLKNKGVMSLCEMLKDPSCVLESLM MLSYCCLTFIACGHLYEALLSNEHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW - UN

I24392 - WLDMCDFTSDCCEDLALVLTTCNTLKSLNLDWNAFDHSGLEMLCKALNHKACNLEVLG GLDKSLFSEESQTLLQAVEKKNKNLKVLHFPW

LKEELEKRGVRL KLLEVERAGIGFPGTVVTGNNELPG GMKSLPPESTRSTGGTVTSLV

For any suggestions or comments, please send an email to unitrap@crg.es