Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054385 (Ceacam2)
Chromosomal location
Chr 7: 26301062 - 26324806 (-)
Description
carcinoembryonic antigen-related cell adhesion molecule 2 Gene [Source:MGI Symbol;Acc:MGI:1347246]
RefSeq_dna
NM_007543 
RefSeq_peptide
NP_031569.1 NP_001106840.1 NP_001106839.1 
UniGene
Mm.439731 
MGI
MGI:1347246 
Uniprot/SWISSPROT
Q925P2 
Human Ortholog
not available
Omim not available
UniTrap UNI31582
Vector Insertion
Chr 7: 26315489 - 26323953
Public Clones IST10709C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36706
Vector Insertion
Chr 7: 26304177 - 26305035
Public Clones IST11364F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34728
Vector Insertion
Chr 7: 26301061 - 26304210
Public Clones IST14925F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064862
Sequence
AGAAGCTAGCAGGCAGAAGAGACATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGTTTGGACTACTGCTCACAG - UNI31582 -

 CCTCACTTTTAGCCTCCTGGAGCCCTCCCACCACTGCACAAGTGACTGTTATGGCTTTTCCACTCCACGCTGCTGAAGGCAACAATGTTATTCTAGTTG

TTTACAATATGATGAAGGGAGTCTCGGCCTTTAGCTGGCACAAGGGATCTACTACGTCTACAAATGCTGAAATTGTACGATTTGTAACAGGCACTAATAA

GACTATAAAAGGGCCTGTACACAGTGGCAGAGAGACACTATACAGCAATGGATCCCTGCTCATCCAAAGGGTCACCATGAAGGATACGGGAGTCTACACA

ATAGAAATGACAGATCAAAACTATCGTCGTAGGGTCCTGACTGGACAATTTCATGTACACA - UNI31582 - AGCCAGTGACTCAGCCCTCCCTCCA

AGTCACCAACACCACAGTCAAAGAACTAGACTCTGTCACCCTGACCTGCTTGTCGAAAGACCGTCAAGCCCACATCCATTGGATCTTCAACAATGATACT

CTTCTAATCACAGAGAAGATGACAACCTCTCAGGCGGGACTCATCCTCAAAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCT

CGAATCCAGTCAGCGTCAAGAGGAGCAACTCAATCAAACTGGAAGTAATAT TTGACTCAACATATGACATTTCAGATGTCCCCATTGCTGTAATCATAA

CTGGAGCTGTGGCCGGGGTGATTCTAATAGCAGGGCTGGCATATCGCCTCTGTTCCAGGAAGTCTCGCTG - UNI34728 - - UNI36706 - ATC

TGGCTCCTTCTGACAACTCTCCTAACAAG - UNI34728 - - UNI36706 - GTGGATGACGTCGCATACACTGTCCTGAACTTCAATTCCCAGCA

ACCCAACCGGCCAACTTCAGCCCCTTCTTCTCCAAGAGCCACAGAAACAGTTTATTCAGAAGTAAAAAAGAAGTGAGCATAATCTGTCCGTCTGTCCTGC

TGGCTGCACCAGTGATGCATTCCCAGATTCTCTCCCTCACTGGAGGGTCTCTGCACACACACACACACACACACACACACACACACACACACACACACAC

ACACACTCACTCATGCATTTACTCTGTTGACTCCTTCAGTGTCTATAGAAGAAAAGGTGGATCCTGGAGCCTACAGAAAACTCAACCCTTCTAGGCTTTC

AAATTTGGCTGAGAGTGAGGTATCAAAATTTCTCACCCTTTCACTTTCCTGACCCAGACTGTTTAAAATTGACCTATTCAGAGCACCTTCATTCCCCTCC

CAACTCCAAGTCCTGCCCTGTCAGAGTCTGACTTGAATTTCCATAAACCTTGGAGGTCACCTAAGTGCTTACGCCAAACAAAACAAAACAAAACAAACCA

GAAGCAGGAAATGGCCAGTCCCATCTCTTTAAAGGCTGATTGGAAGCCACCACACATGAGAAGATCAAACCTCCATGGGCAATCTACACACCCGACAACT

GTCATGCTTACCCATCTGGGGCATTCGAGTCTCTGAACCTTGTGTCCTCACGCCTGAGCCCTTCTCTGAGCCTTTCTCCAGAAAATCCACTCACAGCAAC

TAGAGAGGCTCTTTGTCAGCAACTCCAAGCAAACTGCTAGGCAGGATTCAGAAGAAAAGACAGCATCTCTAACATCCACCAGGAAGGTGCCCAGAAAAGC

AGAGCTGGTGACTTTGGACTGACAGACATCTGGAGTGTGAAAAAGCAGCACAGAGCTAACCTTCGGAGAGTGTTGAAATTATTTGAAAAGAAGCCATATT

TGGAGGTATTGGAGTTTTCCTCTTTCTGAGACAATCCACTATTTGAAAATTGTAGCTACTGAATTGCCTCTCAGTATGCAAGCTGATCACTTTGCCTTAG

GGCCACTAGATTTCTGTCTCCCTTGGCCCCTCAAGCCCTTTTGATCATGAGTCCCAAACCAAAAATAAATGAACACTGAGGCAGTCCCTTGCAGAACCAC

TGTCATGGGTCAGGCTAAGCCTCCTGCTTTTCTGAATTAGTCAAGAAAAGCCTTGGTTTCCCTTTTTCCATCTTTTTATCTTGTCTTTCAGATACTGGCC

AGAGCCTGGACACTCTTCCTCTGAGATCTCCAGCTTCTCTGCCTTCTTGTGTTTCTTTTAAACTCTAACAAAAACTGTTCTCACCTTCAAAAAATAAAAT

AATAACAAGCTTTCCACATCCCCACCAAAGAGGGACCCAGCTAGGTTTCTGGGAACCCAGCACCAGCCTCCAGCTGCCCTTCTGCAGTGTTTCTGCCTCT

GTTTCCCTTTCGTTTTGACTTTTTTCCTTCTTTTGAGACAGAGTTCCAGCATGGAGCCTGTGCAGGTTTCAATCCCACAGTAACACCTTCTGCAGCACCC

CACCTGCTCAGACTGCAGCCCTGGCCACCAGGCCTGGCTACCTGGACATTCTGTCTGTCCTGCACTCTCAGGAAACCTTGGCCTCTGCTACTGTCTGTTT

GGCTCATTCAAAGTGTGTCCTTAAAGGAATGCAGTCACCCATGCCAGAGGCAGTGTTTACAGCCTGGAATGCTCTGCACTTCCAGTGGACCAGTGCTCCA

CCGGAAGTGGGCTGTTAGCAGGGTCCTCTCACCTGGCCCTGGCCTTTCTGTAGCCTTGAATCCTGCCTTCCCCACCAGGGCACCAGGGATGAGTGCAGCA

GCAGGAGGAGAGGCAAACAGTCACCTCAGGAACCTTCTGAGCTAAGGCACACCCTCTGTGCCTGTCAAGCAAAGGTTGTATTGGATATCAAGTGTTTGGT

CTCACGCCAAGCCAACAGGCTTTGGAGAGAATTAATTAGTTCTCCTACTCAGGGATTTCTTTCAGTCCTAACACAGCCTGTGTATATTTTGCTTCACCCA

CGCAATGCTGGATTATTTAATTTTGCCCGGCTTAAGACAAATCTGAGTTACTTGTAAATTTGCTCTATGTTCATAAAAAAAGTTCATTATATATCACTG
Translation
MELASAHLHKGQVPWFGLLLTA - UNI31582 - ASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTG

TNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHK - UNI31582 - KPVTQPSLQVTNTTVKELDSVTLTCLSKD

RQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVIF FDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCS

RKSR - UNI34728 - - UNI36706 - R - UNI34728 - - UNI36706 - 
Transcript ENSMUST00000066503
Sequence
AGAAGCTAGCAGGCAGAAGAGACATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGTTTGGACTACTGCTCACAG - UNI31582 -

 CCTCACTTTTAGCCTCCTGGAGCCCTCCCACCACTGCACAAGTGACTGTTATGGCTTTTCCACTCCACGCTGCTGAAGGCAACAATGTTATTCTAGTTG

TTTACAATATGATGAAGGGAGTCTCGGCCTTTAGCTGGCACAAGGGATCTACTACGTCTACAAATGCTGAAATTGTACGATTTGTAACAGGCACTAATAA

GACTATAAAAGGGCCTGTACACAGTGGCAGAGAGACACTATACAGCAATGGATCCCTGCTCATCCAAAGGGTCACCATGAAGGATACGGGAGTCTACACA

ATAGAAATGACAGATCAAAACTATCGTCGTAGGGTCCTGACTGGACAATTTCATGTACACA - UNI31582 - AGCCAGTGACTCAGCCCTCCCTCCA

AGTCACCAACACCACAGTCAAAGAACTAGACTCTGTCACCCTGACCTGCTTGTCGAAAGACCGTCAAGCCCACATCCATTGGATCTTCAACAATGATACT

CTTCTAATCACAGAGAAGATGACAACCTCTCAGGCGGGACTCATCCTCAAAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCT

CGAATCCAGTCAGCGTCAAGAGGAGCAACTCAATCAAACTGGAAGTAATAT TTGACTCAACATATGACATTTCAGATGTCCCCATTGCTGTAATCATAA

CTGGAGCTGTGGCCGGGGTGATTCTAATAGCAGGGCTGGCATATCGCCTCTGTTCCAGGAAGTCTCGCTG - UNI36706 - GGGAAGTGACCAGCGA

GATCTCACAGAGCACAAACCCTCAGCCTCCAACCACA - UNI34728 - - UNI36706 - ATCTGGCTCCTTCTGACAACTCTCCTAACAAG - U

NI34728 - - UNI36706 - GTGGATGACGTCGCATACACTGTCCTGAACTTCAATTCCCAGCAACCCAACCGGCCAACTTCAGCCCCTTCTTCTCC

AAGAGCCACAGAAACAGTTTATTCAGAAGTAAAAAAGAAGTGAGCATAATCTGTCCGTCTGTCCTGCTGGCTGCACCAGTGATGCATTCCCAGATTCTCT

CCCTCACTGGAGGGTCTCTGCACACACACACACACACACACACACACACACACACACACACACACACACACACTCACTCATGCATTTACTCTGTTGACTC

CTTCAGTGTCTATAGAAGAAAAGGTGGATCCTGGAGCCTACAGAAAACTCAACCCTTCTAGGCTTTCAAATTTGGCTGAGAGTGAGGTATCAAAATTTCT

CACCCTTTCACTTTCCTGACCCAGACTGTTTAAAATTGACCTATTCAGAGCACCTTCATTCCCCTCCCAACTCCAAGTCCTGCCCTGTCAGAGTCTGACT

TGAATTTCCATAAACCTTGGAGGTCACCTAAGTGCTTACGCCAAACAAAACAAAACAAAACAAACCAGAAGCAGGAAATGGCCAGTCCCATCTCTTTAAA

GGCTGATTGGAAGCCACCACACATGAGAAGATCAAACCTCCATGGGCAATCTACACACCCGACAACTGTCATGCTTACCCATCTGGGGCATTCGAGTCTC

TGAACCTTGTGTCCTCACGCCTGAGCCCTTCTCTGAGCCTTTCTCCAGAAAATCCACTCACAGCAACTAGAGAGGCTCTTTGTCAGCAACTCCAAGCAAA

CTGCTAGGCAGGATTCAGAAGAAAAGACAGCATCTCTAACATCCACCAGGAAGGTGCCCAGAAAAGCAGAGCTGGTGACTTTGGACTGACAGACATCTGG

AGTGTGAAAAAGCAGCACAGAGCTAACCTTCGGAGAGTGTTGAAATTATTTGAAAAGAAGCCATATTTGGAGGTATTGGAGTTTTCCTCTTTCTGAGACA

ATCCACTATTTGAAAATTGTAGCTACTGAATTGCCTCTCAGTATGCAAGCTGATCACTTTGCCTTAGGGCCACTAGATTTCTGTCTCCCTTGGCCCCTCA

AGCCCTTTTGATCATGAGTCCCAAACCAAAAATAAATGAACACTGAGGCAGTCCCTTGCAGAACCACTGTCATGGGTCAGGCTAAGCCTCCTGCTTTTCT

GAATTAGTCAAGAAAAGCCTTGGTTTCCCTTTTTCCATCTTTTTATCTTGTCTTTCAGATACTGGCCAGAGCCTGGACACTCTTCCTCTGAGATCTCCAG

CTTCTCTGCCTTCTTGTGTTTCTTTTAAACTCTAACAAAAACTGTTCTCACCTTCAAAAAATAAAATAATAACAAGCTTTCCACATCCCCACCAAAGAGG

GACCCAGCTAGGTTTCTGGGAACCCAGCACCAGCCTCCAGCTGCCCTTCTGCAGTGTTTCTGCCTCTGTTTCCCTTTCGTTTTGACTTTTTTCCTTCTTT

TGAGACAGAGTTCCAGCATGGAGCCTGTGCAGGTTTCAATCCCACAGTAACACCTTCTGCAGCACCCCACCTGCTCAGACTGCAGCCCTGGCCACCAGGC

CTGGCTACCTGGACATTCTGTCTGTCCTGCACTCTCAGGAAACCTTGGCCTCTGCTACTGTCTGTTTGGCTCATTCAAAGTGTGTCCTTAAAGGAATGCA

GTCACCCATGCCAGAGGCAGTGTTTACAGCCTGGAATGCTCTGCACTTCCAGTGGACCAGTGCTCCACCGGAAGTGGGCTGTTAGCAGGGTCCTCTCACC

TGGCCCTGGCCTTTCTGTAGCCTTGAATCCTGCCTTCCCCACCAGGGCACCAGGGATGAGTGCAGCAGCAGGAGGAGAGGCAAACAGTCACCTCAGGAAC

CTTCTGAGCTAAGGCACACCCTCTGTGCCTGTCAAGCAAAGGTTGTATTGGATATCAAGTGTTTGGTCTCACGCCAAGCCAACAGGCTTTGGAGAGAATT

AATTAGTTCTCCTACTCAGGGATTTCTTTCAGTCCTAACACAGCCTGTGTATATTTTGCTTCACCCACGCAATGCTGGATTATTTAATTTTGCCCGGCTT

AAGACAAATCTGAGTTACTTGTAAATTTGCTCTATGTTCATAAAAAAAGTTCATTATATATCACTG
Translation
MELASAHLHKGQVPWFGLLLTA - UNI31582 - ASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTG

TNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHK - UNI31582 - KPVTQPSLQVTNTTVKELDSVTLTCLSKD

RQAHIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVIF FDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCS

RKSRW - UNI36706 - WGSDQRDLTEHKPSASNHN - UNI34728 - - UNI36706 - NLAPSDNSPNK - UNI34728 - - UNI36706

 - VDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK
Transcript ENSMUST00000044547
Sequence
AGAAGCTAGCAGGCAGAAGAGACATGGAGCTGGCCTCAGCACATCTCCACAAAGGGCAGGTTCCCTGGTTTGGACTACTGCTCACAG - UNI31582 -

 CCTCACTTTTAGCCTCCTGGAGCCCTCCCACCACTGCACAAGTGACTGTTATGGCTTTTCCACTCCACGCTGCTGAAGGCAACAATGTTATTCTAGTTG

TTTACAATATGATGAAGGGAGTCTCGGCCTTTAGCTGGCACAAGGGATCTACTACGTCTACAAATGCTGAAATTGTACGATTTGTAACAGGCACTAATAA

GACTATAAAAGGGCCTGTACACAGTGGCAGAGAGACACTATACAGCAATGGATCCCTGCTCATCCAAAGGGTCACCATGAAGGATACGGGAGTCTACACA

ATAGAAATGACAGATCAAAACTATCGTCGTAGGGTCCTGACTGGACAATTTCATGTACACA - UNI31582 - CCCTATTACTAAAGTCCAACATCAC

AAGCAACAACTCCAATCCCGTAGAGGGTGACGACTCCGTATCATTAACCTGTGACTCTTACACTGACCCTGATAATATAACCTACCTGTGGAGCAGAAAT

GGTGAAAGCCTTTCAGAAGGTGACAGGCTGAAGCTGTCTGAGGGCAACAGGACTCTCACTTTACTCAATGTCACGAGGAATGACACAGGACCCTATGTGT

GTGAAACCCGGAACCCAGTGAGTGTCAACCGAAGTGACCCATTCAGCCTGAACATTATCT - UNI31582 - ATGGTCCGGACACCCCGATTATATCC

CCCTCAGATATTTATTTGCATCCAGGGTCAAACCTCAACCTCTCCTGCCATGCAGCCTCTAACCCACCTGCACAGTACTTTTGGCTTATCAATGAGAAGC

CCCATGCATCCTCCCAAGAGCTCTTTATCCCCAACATCACTACTAATAATAGCGGAACCTATACCTGCTTCGTCAATAACTCTGTCACTGGCCTCAGTAG

GACCACAGTCAAGAACATTACAGTCCTTG AGCCAGTGACTCAGCCCTCCCTCCAAGTCACCAACACCACAGTCAAAGAACTAGACTCTGTCACCCTGAC

CTGCTTGTCGAAAGACCGTCAAGCCCACATCCATTGGATCTTCAACAATGATACTCTTCTAATCACAGAGAAGATGACAACCTCTCAGGCGGGACTCATC

CTCAAAATAGACCCTATTAAGAGGGAAGATGCCGGCGAGTATCAGTGTGAAATCTCGAATCCAGTCAGCGTCAAGAGGAGCAACTCAATCAAACTGGAAG

TAATAT TTGACTCAACATATGACATTTCAGATGTCCCCATTGCTGTAATCATAACTGGAGCTGTGGCCGGGGTGATTCTAATAGCAGGGCTGGCATATC

GCCTCTGTTCCAGGAAGTCTCGCTG - UNI36706 - GGGAAGTGACCAGCGAGATCTCACAGAGCACAAACCCTCAGCCTCCAACCACA - UNI34

728 - - UNI36706 - ATCTGGCTCCTTCTGACAACTCTCCTAACAAG - UNI34728 - - UNI36706 - GTGGATGACGTCGCATACACTG

TCCTGAACTTCAATTCCCAGCAACCCAACCGGCCAACTTCAGCCCCTTCTTCTCCAAGAGCCACAGAAACAGTTTATTCAGAAGTAAAAAAGAAGTGAGC

ATAATCTGTCCGTCTGTCCTGCTGGCTGCACCAGTGATGCATTCCCAGATTCTCTCCCTCACTGGAGGGTCTCTGCACACACACACACACACACACACAC

ACACACACACACACACACACACACACACTCACTCATGCATTTACTCTGTTGACTCCTTCAGTGTCTATAGAAGAAAAGGTGGATCCTGGAGCCTACAGAA

AACTCAACCCTTCTAGGCTTTCAAATTTGGCTGAGAGTGAGGTATCAAAATTTCTCACCCTTTCACTTTCCTGACCCAGACTGTTTAAAATTGACCTATT

CAGAGCACCTTCATTCCCCTCCCAACTCCAAGTCCTGCCCTGTCAGAGTCTGACTTGAATTTCCATAAACCTTGGAGGTCACCTAAGTGCTTACGCCAAA

CAAAACAAAACAAAACAAACCAGAAGCAGGAAATGGCCAGTCCCATCTCTTTAAAGGCTGATTGGAAGCCACCACACATGAGAAGATCAAACCTCCATGG

GCAATCTACACACCCGACAACTGTCATGCTTACCCATCTGGGGCATTCGAGTCTCTGAACCTTGTGTCCTCACGCCTGAGCCCTTCTCTGAGCCTTTCTC

CAGAAAATCCACTCACAGCAACTAGAGAGGCTCTTTGTCAGCAACTCCAAGCAAACTGCTAGGCAGGATTCAGAAGAAAAGACAGCATCTCTAACATCCA

CCAGGAAGGTGCCCAGAAAAGCAGAGCTGGTGACTTTGGACTGACAGACATCTGGAGTGTGAAAAAGCAGCACAGAGCTAACCTTCGGAGAGTGTTGAAA

TTATTTGAAAAGAAGCCATATTTGGAGGTATTGGAGTTTTCCTCTTTCTGAGACAATCCACTATTTGAAAATTGTAGCTACTGAATTGCCTCTCAGTATG

CAAGCTGATCACTTTGCCTTAGGGCCACTAGATTTCTGTCTCCCTTGGCCCCTCAAGCCCTTTTGATCATGAGTCCCAAACCAAAAATAAATGAACACTG

AGGCAGTCCCTTGCAGAACCACTGTCATGGGTCAGGCTAAGCCTCCTGCTTTTCTGAATTAGTCAAGAAAAGCCTTGGTTTCCCTTTTTCCATCTTTTTA

TCTTGTCTTTCAGATACTGGCCAGAGCCTGGACACTCTTCCTCTGAGATCTCCAGCTTCTCTGCCTTCTTGTGTTTCTTTTAAACTCTAACAAAAACTGT

TCTCACCTTCAAAAAATAAAATAATAACAAGCTTTCCACATCCCCACCAAAGAGGGACCCAGCTAGGTTTCTGGGAACCCAGCACCAGCCTCCAGCTGCC

CTTCTGCAGTGTTTCTGCCTCTGTTTCCCTTTCGTTTTGACTTTTTTCCTTCTTTTGAGACAGAGTTCCAGCATGGAGCCTGTGCAGGTTTCAATCCCAC

AGTAACACCTTCTGCAGCACCCCACCTGCTCAGACTGCAGCCCTGGCCACCAGGCCTGGCTACCTGGACATTCTGTCTGTCCTGCACTCTCAGGAAACCT

TGGCCTCTGCTACTGTCTGTTTGGCTCATTCAAAGTGTGTCCTTAAAGGAATGCAGTCACCCATGCCAGAGGCAGTGTTTACAGCCTGGAATGCTCTGCA

CTTCCAGTGGACCAGTGCTCCACCGGAAGTGGGCTGTTAGCAGGGTCCTCTCACCTGGCCCTGGCCTTTCTGTAGCCTTGAATCCTGCCTTCCCCACCAG

GGCACCAGGGATGAGTGCAGCAGCAGGAGGAGAGGCAAACAGTCACCTCAGGAACCTTCTGAGCTAAGGCACACCCTCTGTGCCTGTCAAGCAAAGGTTG

TATTGGATATCAAGTGTTTGGTCTCACGCCAAGCCAACAGGCTTTGGAGAGAATTAATTAGTTCTCCTACTCAGGGATTTCTTTCAGTCCTAACACAGCC

TGTGTATATTTTGCTTCACCCACGCAATGCTGGATTATTTAATTTTGCCCGGCTTAAGACAAATCTGAGTTACTTGTAAATTTGCTCTATGTTCATAAAA

AAAGTTCATTATATATCACTG
Translation
MELASAHLHKGQVPWFGLLLTA - UNI31582 - ASLLASWSPPTTAQVTVMAFPLHAAEGNNVILVVYNMMKGVSAFSWHKGSTTSTNAEIVRFVTG

TNKTIKGPVHSGRETLYSNGSLLIQRVTMKDTGVYTIEMTDQNYRRRVLTGQFHVHT - UNI31582 - TLLLKSNITSNNSNPVEGDDSVSLTCDSY

TDPDNITYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNIIY - UNI31582 - YGPDTPIISPSDIYLHPGS

NLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLE EPVTQPSLQVTNTTVKELDSVTLTCLSKDRQA

HIHWIFNNDTLLITEKMTTSQAGLILKIDPIKREDAGEYQCEISNPVSVKRSNSIKLEVIF FDSTYDISDVPIAVIITGAVAGVILIAGLAYRLCSRKS

RW - UNI36706 - WGSDQRDLTEHKPSASNHN - UNI34728 - - UNI36706 - NLAPSDNSPNK - UNI34728 - - UNI36706 - 

VDDVAYTVLNFNSQQPNRPTSAPSSPRATETVYSEVKKK

For any suggestions or comments, please send an email to unitrap@crg.es