Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054484 (Tmem62)
Chromosomal location
Chr 2: 120802798 - 120833569 (+)
Description
transmembrane protein 62 Gene [Source:MGI (curated);Acc:Tmem62-001]
RefSeq_dna
NM_175285 
RefSeq_peptide
NP_780494.1 
UniGene
Mm.315212 Mm.472565 
MGI
MGI:2139461 
Uniprot/SWISSPROT
Q8BXJ9 
Uniprot/SPTREMBL
A2AQ55 A2AQ56 
Human Ortholog
ENSG00000137842 (TMEM62)
Omim not available
UniTrap UNI35662
Vector Insertion
Chr 2: 120803547 - 120804866
Public Clones IST13078G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25635
Vector Insertion
Chr 2: 120804866 - 120805005
Public Clones not available
Private Clones OST172907 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31425
Vector Insertion
Chr 2: 120806255 - 120810069
Public Clones IST14933E7 (tigm) IST14770G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38625
Vector Insertion
Chr 2: 120810212 - 120812318
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21744
Vector Insertion
Chr 2: 120819374 - 120822141
Public Clones not available
Private Clones OST319094 (lexicon) OST110781 (lexicon)
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067582
Sequence
GCTTTACAGGTGCTGAGGTCGCACCACGGTCAGGGATGCCAGACCCTGGTGGAGCCAGGTGGCGAGCTGCCTCCCTGCCACCCCCTCGCTTGGCTCTTCC

TGGTCCTCACTAGGTTGTCAAACGCCGGGCAACCGGGCTGCCGCGGCGCGGAGGCCTGGGCTGAGGCGAGTTGCGGAGGCGGCGGGAGGCCACAGAGGCC

GGAAGTGCGGGCCGGAGCGCTCCGGGGCTGCGCCGAGATGGCGAGAATGCTGGCGGTCCGGGTGGTGGCAGGGCTGGCGGCGGCCGCGGTGGCCGCCCTG

CTGTTGGAGCACTACGGCCTGGCTGGGCCGACTACGCCGCTGCCGAAGCCCAGAGGCTCCCAGAGGCCGCACCCCGCCCCGGGCTCGGAAGCCAACAACA

TCTTCTGGGGGCTGCAG ATATCCGACATTCACCTGAGCAGATTTCAAGATCCAGGCAGAGCGCTGGCCTTAGAGAAGTTCTGTTCGGAAACTATTGACA

TCATTCAACCGGCTCTTGTCCTGGCCACTG - UNI25635 - - UNI35662 - GAGACCTGACAGATGCCAAAACAAAGGAACACTTGGGATCCAG

ACAACATGAAGTAGAATGGCAAACTTACCAGAGAATTCTGAAAAAGACAAGAGTCATGGAAAAAACCAAGTGGCTGGATATCAAAGGAAATCATG - UN

I25635 - ATGCATATAACATCCCAAGTCTGGAGAGCATCGCCAATTATTACAG - UNI31425 - GAAGTACTCTGCTGTGCGGAAGGACGGCGCT

TTTCATCACATCCACAGCACTCCCTTTGGCAACTATTCCTTCATCTCTGTGGATGCCACCCAAAGGCCAGGGCCTAAGAGACCCTATAATTTCTTTGGCA

TTTTAGATGAG AAACAGATGGAGGAACTCGTAGAGTTTTCCAAGAAAAGCAGTCAGAGCAACCAGACGATTTGGTTTGGCCACTTTACAACATCAACTA

TCATGTCTCCATCCCCAGGGATCCGGACAGTAATGGG TTCCGCTACAGCTTATCTGTGTGGGCACCTCCATACGCTTGGTGGGCTGATGCCTGTTCTGC

ACACCCGTCACTTCACAGGCACGCTGGAACTTGAGGTGGGAGACTGGAAAGACAACAGAAG GTACCGGATCTTTGCCTTTGATCACGACCTCTTTAGCT

TTGCAGATGTAACCTTTGACAAGTGGCCTGTGGTTCTCATCACCAATCCCAAATCCCTCCTCTATAGCTGTGCTAAGCATGAGCCGCTAGAAAGGCTCTT

CCATTCCACACACATAAG AGTATTGGCCTTTTCCTTATCCCCCATCACTTCTGTCACTGTTAAGATTGATGGAGGTGATATAGGCCAGGCTTCTCACTT

GTCTGGTCCTATTTTCATACTGAAGTGGAACCCTAGAAACTACAGTAATGGGACACATACCATAGAAGTATTCGTCCAG - UNI21744 - GATTCTG

CTGGAAGAAGTAGGACTGCTCACCACATATTTTCTGCCCAAGAGGATGCTCATCTCACATTTGATCCTTTGGCATCATTTATCCTCCTTACTGACCACTA

CATTGTG GCCCGGGTCCTGTTTGTGTTGATTGTGCTGATCCAGCTCACCACACTGATTACATTCAGATATCTAGCATACCCAGAGCTTAAAG AACCTC

TGGGATTTGCAAATATGACCACATTTTCCCTTCATATCTTGAGCAAAATAAACATCTCCTACTATTCTGTTTTGTTGTTGACCTTGTATACAGTGCTGG 

GACCATGGTTTGTTGGTGAGATAATTGATGGCAAATTGGGTTGCTGCTTTTCATTTGGGATATTTGTTGATGGACATTTCCTGCAAGGTGGTCTAACATT

TATAAATGGAATTATACAG CTGGTGTTCTTTAACATCCCCTTGATGGCTTACGTATGCTGGAGTTTGCTACATCGCTGCTTTGGTCACAGCTTCAGGTC

TCATCTCCACCAGGGAAAATACTGGAAGATTATACCTGTTTACCTACTTATACTTCTACTGTACATATGGCAGGTTTATTCTTGCTACTTTCTTCATGTG

ACATATGGCTCCCTAGCCTTTACATTCTCTCCATTGAGGACCTGGTTGACATTGCTGACACCTGTGCTCATTTACCGTGTGTGGACATTGAACTCCACTG

AACTTGGAATATTCATGGTGCAGTTAAAAAGTCATCTGAGCTCCTGAAGTCCATGGCTTACAGCTAGCAGCCTGGAAGAAGTCCAGCCTCCACATTTGTG

GCTCAGATCTCTGCCCTGTGGCAGATGGGAAAGCCAGTATCAGTGGGTGAGCTTCAGGAAGCAGTCACTCCTTGGACATCTGAATGTTGGAAATGTTTAC

TACTGATTCTTGCTGTGTGGACTGCAGAAAAGTCTAACAATTGATTCTTCCTCAGGAGGCAAAGAGCCCTAATCAAGAAGATTGCCACAGTGGGGTCTCT

GTGTCACTGTGTCCCTTGGTACTACTGTGTTTATTAGGGTCATCCTGTGAAAAGCATCCAGCCCGAACTTGGAGTTCAGGATGTCATTTTCTGCCTAGGG

AGCCTGTGGAAACTTGTCCTGGACCTTTACTGCTCCTGAGACTTGACTTCCCAGCCTGTTTCCCCACCGATCATGGGCTTTCTGCTTCCTTAGCCAAGGT

TGTTTTCAACTAATCAAATAAATGAATGAATGGTAGCCATAAACAATGGGTTGGAGAGATCAGTGGTTAAGAGCATGTACTTTACCTCCAGAAGACCCGA

GTTCAATCCCTAGCAACCATGTCAGATGCTCACAACTGCCTGTAACTCTAGCTCCAGGCCAGAGCCACTGTGGGCACCTACATTCATATGTGCACAGACT

TACATGTGATTAAAAAATAATAAAAGATAAGTATT
Translation
MARMLAVRVVAGLAAAAVAALLLEHYGLAGPTTPLPKPRGSQRPHPAPGSEANNIFWGLQ ISDIHLSRFQDPGRALALEKFCSETIDIIQPALVLATG 

- UNI25635 - - UNI35662 - GDLTDAKTKEHLGSRQHEVEWQTYQRILKKTRVMEKTKWLDIKGNHD - UNI25635 - DAYNIPSLESIAN

YYR - UNI31425 - RKYSAVRKDGAFHHIHSTPFGNYSFISVDATQRPGPKRPYNFFGILDE KQMEELVEFSKKSSQSNQTIWFGHFTTSTIMSPS

PGIRTVMG GSATAYLCGHLHTLGGLMPVLHTRHFTGTLELEVGDWKDNRR RYRIFAFDHDLFSFADVTFDKWPVVLITNPKSLLYSCAKHEPLERLFH

STHIR RVLAFSLSPITSVTVKIDGGDIGQASHLSGPIFILKWNPRNYSNGTHTIEVFVQ - UNI21744 - DSAGRSRTAHHIFSAQEDAHLTFDPL

ASFILLTDHYIV ARVLFVLIVLIQLTTLITFRYLAYPELKE EPLGFANMTTFSLHILSKINISYYSVLLLTLYTVLG GPWFVGEIIDGKLGCCFSFG

IFVDGHFLQGGLTFINGIIQ LVFFNIPLMAYVCWSLLHRCFGHSFRSHLHQGKYWKIIPVYLLILLLYIWQVYSCYFLHVTYGSLAFTFSPLRTWLTLL

TPVLIYRVWTLNSTELGIFMVQLKSHLSS
Transcript ENSMUST00000110686
Sequence
GGGGGCCTCGGTCGCAGTCCGCCGGGAGGCTCGGCTCTCCTTCCCCGGGGTTCGTTAGGGCATCTTTTTCTTTCCCTTCCGCTCCCCGAGAGCTGACGGG

CCACCCGTGTCGGTGCGGCTCTTCCTGACTCAGATAACGTGTCTGTCCAATGCCTGCTTTTGACAGATATCCGACATTCACCTGAGCAGATTTCAAGATC

CAGGCAGAGCGCTGGCCTTAGAGAAGTTCTGTTCGGAAACTATTGACATCATTCAACCGGCTCTTGTCCTGGCCACTG - UNI25635 - - UNI356

62 - GAGACCTGACAGATGCCAAAACAAAGGAACACTTGGGATCCAGACAACATGAAGTAGAATGGCAAACTTACCAGAGAATTCTGAAAAAGACAAGA

GTCATGGAAAAAACCAAGTGGCTGGATATCAAAGGAAATCATG - UNI25635 - ATGCATATAACATCCCAAGTCTGGAGAGCATCGCCAATTATTA

CAG - UNI31425 - GAAGTACTCTGCTGTGCGGAAGGACGGCGCTTTTCATCACATCCACAGCACTCCCTTTGGCAACTATTCCTTCATCTCTGTGG

ATGCCACCCAAAGGCCAGGGCCTAAGAGACCCTATAATTTCTTTGGCATTTTAGATGAG AAACAGATGGAGGAACTCGTAGAGTTTTCCAAGAAAAGCA

GTCAGAGCAACCAGACGATTTGGTTTGGCCACTTTACAACATCAACTATCATGTCTCCATCCCCAGGGATCCGGACAGTAATGGG TTCCGCTACAGCTT

ATCTGTGTGGGCACCTCCATACGCTTGGTGGGCTGATGCCTGTTCTGCACACCCGTCACTTCACAGGCACGCTGGAACTTGAGGTGGGAGACTGGAAAGA

CAACAGAAG GTACCGGATCTTTGCCTTTGATCACGACCTCTTTAGCTTTGCAGATGTAACCTTTGACAAGTGGCCTGTGGTTCTCATCACCAATCCCAA

ATCCCTCCTCTATAGCTGTGCTAAGCATGAGCCGCTAGAAAGGCTCTTCCATTCCACACACATAAG AGTATTGGCCTTTTCCTTATCCCCCATCACTTC

TGTCACTGTTAAGATTGATGGAGGTGATATAGGCCAGGCTTCTCACTTGTCTGGTCCTATTTTCATACTGAAGTGGAACCCTAGAAACTACAGTAATGGG

ACACATACCATAGAAGTATTCGTCCAG - UNI21744 - GATTCTGCTGGAAGAAGTAGGACTGCTCACCACATATTTTCTGCCCAAGAGGATGCTCA

TCTCACATTTGATCCTTTGGCATCATTTATCCTCCTTACTGACCACTACATTGTG GCCCGGGTCCTGTTTGTGTTGATTGTGCTGATCCAGCTCACCAC

ACTGATTACATTCAGATATCTAGCATACCCAGAGCTTAAAG AACCTCTGGGATTTGCAAATATGACCACATTTTCCCTTCATATCTTGAGCAAAATAAA

CATCTCCTACTATTCTGTTTTGTTGTTGACCTTGTATACAGTGCTGG GACCATGGTTTGTTGGTGAGATAATTGATGGCAAATTGGGTTGCTGCTTTTC

ATTTGGGATATTTGTTGATGGACATTTCCTGCAAGGTGGTCTAACATTTATAAATGGAATTATACAG CTGGTGTTCTTTAACATCCCCTTGATGGCTTA

CGTATGCTGGAGTTTGCTACATCGCTGCTTTGGTCACAGCTTCAGGTCTCATCTCCACCAGGGAAAATACTGGAAGATTATACCTGTTTACCTACTTATA

CTTCTACTGTACATATGGCAGGTTTATTCTTGCTACTTTCTTCATGTGACATATGGCTCCCTAGCCTTTACATTCTCTCCATTGAGGACCTGGTTGACAT

TGCTGACACCTGTGCTCATTTACCGTGTGTGGACATTGAACTCCACTGAACTTGGAATATTCATGGTGCAGTTAAAAAGTCATCTGAGCTCCTGAAGTCC

ATGGCTTACAGCTAGCAGCCTGGAAGAAGTCCAGCCTCCACATTTGTGGCTCAGATCTCTGCCCTGTGGCAGATGGGAAAGCCAGTATCAGTGGGTGAGC

TTCAGGAAGCAGTCACTCCTTGGACATCTGAATGTTGGAAATGTTTACTACTGATTCTTGCTGTGTGGACTGCAGAAAAGTCTAACAATTGATTCTTCCT

CAGGAGGCAAAGAGCCCTAATCAAGAAGATTGCCACAGTGGGGTCTCTGTGTCACTGTGTCCCTTGGTACTACTGTGTTTATTAGGGTCATCCTGTGAAA

AGCATCCAGCCCGAACTTGGAGTTCAGGATGTCATTTTCTGCCTAGGGAGCCTGTGGAAACTTGTCCTGGACCTTTACTGCTCCTGAGACTTGACTTCCC

AGCCTGTTTCCCCACCGATCATGGGCTTTCTGCTTCCTTAGCCAAGGTTGTTTTCAACTAATCAAATAAATGAATGAATGGTAGCCATAAACAA
Translation
 - UNI25635 - - UNI35662 - MEKTKWLDIKGNHD - UNI25635 - DAYNIPSLESIANYYR - UNI31425 - RKYSAVRKDGAFHHI

HSTPFGNYSFISVDATQRPGPKRPYNFFGILDE KQMEELVEFSKKSSQSNQTIWFGHFTTSTIMSPSPGIRTVMG GSATAYLCGHLHTLGGLMPVLHT

RHFTGTLELEVGDWKDNRR RYRIFAFDHDLFSFADVTFDKWPVVLITNPKSLLYSCAKHEPLERLFHSTHIR RVLAFSLSPITSVTVKIDGGDIGQAS

HLSGPIFILKWNPRNYSNGTHTIEVFVQ - UNI21744 - DSAGRSRTAHHIFSAQEDAHLTFDPLASFILLTDHYIV ARVLFVLIVLIQLTTLITF

RYLAYPELKE EPLGFANMTTFSLHILSKINISYYSVLLLTLYTVLG GPWFVGEIIDGKLGCCFSFGIFVDGHFLQGGLTFINGIIQ LVFFNIPLMAY

VCWSLLHRCFGHSFRSHLHQGKYWKIIPVYLLILLLYIWQVYSCYFLHVTYGSLAFTFSPLRTWLTLLTPVLIYRVWTLNSTELGIFMVQLKSHLSS

For any suggestions or comments, please send an email to unitrap@crg.es