Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054574 (AC145736.4-202)
Chromosomal location
Chr 9: 104102767 - 104165264 (-)
Description
Putative uncharacterized protein Fragment  [Source:UniProtKB/TrEMBL;Acc:Q8BNL1]
Uniprot/SPTREMBL
Q8BNL1 
Human Ortholog
not available
Omim not available
UniTrap UNI1455
Vector Insertion
Chr 9: 104149171 - 104165028
Public Clones (sanger) CD0500 (sanger) XL239 (baygenomics) RRT694 (baygenomics) E022B09 (ggtc)
IST14718H2 (tigm)
Private Clones OST368893 (lexicon) OST298217 (lexicon) OST246501 (lexicon) OST237783 (lexicon)
OST171559 (lexicon) OST57220 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4766
Vector Insertion
Chr 9: 104140871 - 104149089
Public Clones AW0665 (sanger) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4747
Vector Insertion
Chr 9: 104118098 - 104120041
Public Clones AX0472 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060084
Sequence
TTAGGGTTCAGCGCTCGCAAGCCTGGTGGAAGATGGCGGCGTCCAGGGCGAGCCTCTGAGAGGCAGAGGGAGGAGCGGAGGGGTGGGGGCCGCGGCGCAG

GAACCCGCGGCGACAGGCCCCGGCGGGGAAAAGGAAAGCGAGAGGGGACGGGGCCGGCGGCGCCTCCATCCTACTCAAGACGTGGAGCCGGCGGCGGGCG

GAGCTCGGGCTGGAGCGCCTCCAGCCTCCTGCGAAG - UNI1455 - GTTTCAGCACAAAATGAACATAATTAGGGAAAATAAGGATCTGGCATGTTT

CTACACAACCAAGCACTCATGGAGGGGAAA - UNI4766 - GTATAAACGAGTCTTTTCAGTTGGAACCCATGCAGTTACTACCTATAATCCCAATAC

CTTAGAAGTAACAAATCAG TGGCCTTATGGAGACATTTGTAGCATCAGCCCTGTTGGGAAAGGACAAGGAACAGAGTTCAACCTCACATTTCGTAAAGG

CAGTGGGAAGAAGTCAGAAACGTTGAAGTTTTCTACAGAGCACAGAACAGAGCTGCTTACGGAGGCTTTG AGATTTAGAACTGACTTTGCAGAGGGAAA

AATCACAGGAAGG AGATATAACTGCTACAAGCATCACTGGAGCGATGCAAAGAAACCTGTGGTTTTGGAAGTAACTCCTGGAGGCTTTGACCAAATAAA

TCCTGTAACCAACAGAGTGCTGTGTTCCTATGACTACAGGAATATTGAAGGCTTCGTAGATCTCTCTGATTATCAGGGAGGATTTTGTATACTCTATGGA

GGATTTAGTAGATTG CATTTATTTTCGTCAGAGCAAAGAGAAGAGATCATTAAAAGTGCAATAGAACACGCTGGCAACTACATAGGTATCTCCCTGCGG

ATCAGGAAAGAGCCACTGGAATTTGAGCAATATTTGAATCTTCGTTTTGGGAAATACAGCACTGATGAATCTATCACATCTTTGGCAGAGTTTGTGGTCC

AAAAAATATCTCCTCGACATTCG GAACCTGTGAAAAGAGTTCTGGCGGTCACAGAAACATGCTTAGTGGAGCGAGATCCAGCAACCTACAACATTGCAA

CATTGAAGCCCCTGGGAGAA GTATTTGCATTGGTTTGTGACTCAGAAAACCCACAACTTTTTACCATTGAGTTTATAAAAGGGCAAGTTCGGAAATACT

CTTCAACAGAAAG AGATTCCTTGTTAGCAAGCTTGCTGGATGGAGTAAGAGCCTCTGGTAACAGAGATGTTTGTGTTAAGATGGCACCGACCCACAAAG

GCCAGCGATGGGGGTTACTCAGCATGCCTATAGACGAGGAAGTCGAGAGCCTTCACCTCAGATTCCTGGCTGCACCTCCTA ATGGCAACTTTGCAGATG

CTGTATTCAGGTTCAACGCTAACATTTCCTACAGTGGAGTGCTGCATGCAGTAACACAGGAT GGTCTCTTCTCAGAAAACAAGGAAAAGCTAATCAATA

ATGCAATAACAGCACTGTTGTCTCAAGAGGGGGATGTTGTAGCCTCAAATGCAGAACTTGAGAGCCAGTTCCAAGCTGTGAGGAGGCTTGTAGCCTCCAA

AGCTGGTTTCCTGGCCTTCACTCAGCTTCCAAA GTTTCGGGAGCGCCTAGGAATGAAGGTAGTGAAAGCACTCAAGAGAAGCAACAACGGAGTCATCCA

TGCGGCTGTGGATATGCTCTGTGCCCTCATGTGT CCTATGCATGATGACTATGACCTAAGACAAGAGCAGCTAAACAAAGCTTCTCTTCTCTCTTCAAA

GAAGTTTCTGGAAAACTTATTGGAGAAATTTAATTCCCATGTG GATCATGGGACCGGTGCCCTAGTAATTAGTTCACTCTTGGACTTCCTTACCTTTGC

CCTCTGTGCTCCATATAGTGAGACAACTGAAGGGCAGCAGTTTGATATGCTCTTAGAGATGGTAGCCTCCAATGGAAGAACCCTTTTTAAACTCTTTCAG

 CATCCTTCCATGGCGATTGTGAAGGGAGCTGGATTGGTTATGAAGGCAATAATAGAG - UNI4747 - GAAGGTGACAGAGAGATTGCTACTAAGAT

GCAGGAGCTCGCCCTAAGTGAGGGTGCCTTACCTCGACACTTACACACTGCGATGTTTACAATCAGTTCAGATCAGCGCATGCTTACGAATAG ACAGCT

AAGTAGACATCTAGTGGGACTCTGGACCGCTGATAACACAACTGCCACAAACTTGTTGAAACGCATATTG CCGCCAGGCTTGTTGGCATACTTGGACAG

TTCAGATCCAGTTCCGGAGAAGGATGCAGACCGCATGCACGTCAGAGACAATGTGAAAATAGCAATG GATCAATATGGAAAATTTAATAAAGTTCCAGA

GTGGCAAAGACTAGCTGGAAAAGCTGCCAAAGAAGTTGAGAAGTTTGCCAAAGAAAAGGTTGACCTTGTGTTGATGCACTGGAGGGATAGGATGGGCATC

GCTCAGAAAGAG AATATAAATCAAAAGCCAGTAGTTCTTCGAAAGAGAAGACAAAGAATAAAAATAGAAGCAAACTGGGATCTCTTCTATTACAG GTT

TAGTCAAGACCACGCTAGATCGAACCTCATTTGGAATTTTAAAACACGAGAAGAACTGAAAGATGCCCTTGAGTCTGAGATGCGGACATTTAACATTGAT

AGGGAGCTGGGCAGCGCCAGTGTCATCTCCTGGAACCACCATGAGTTTGAG GTTAAATATGAGTGCCTGGCAGAGGAAATCAAAATAGGAGACTATTAC

TTGAGATTGTTATTGGAGGAGGATGAAAATGAAGAAAGTGGATCAATAAAAAGATC GTATGAGTTTTTCAATGAGCTCTACCATCGCTTCCTGCTCACT

CCAAAAGTTAACATGAAGTGTTTGTGTTTACAAGCCCTTGCTATCGTTTACGGCAGATGCCATGAAGAAATAGGGCCCTTCACAGATACGAGATACATCA

TTGGGATGTTAGAAAGG TGCACTGATAAACTCGAGCGGGATAGGCTGATCCTCTTCCTCAACAAGCTGATCCTTAATAAG AAAACGTTAAGGATCTCA

TGGACTCAAACGGCATTAGAATTCTTGTGGACTTGCTAACTCTTGCACATCTCCATGTGAGCCGAGCGACAGTCCCCTTGCAG
Translation
 - UNI1455 - MNIIRENKDLACFYTTKHSWRGK - UNI4766 - KYKRVFSVGTHAVTTYNPNTLEVTNQ WPYGDICSISPVGKGQGTEFNLTF

RKGSGKKSETLKFSTEHRTELLTEAL RFRTDFAEGKITGR RYNCYKHHWSDAKKPVVLEVTPGGFDQINPVTNRVLCSYDYRNIEGFVDLSDYQGGFC

ILYGGFSRL HLFSSEQREEIIKSAIEHAGNYIGISLRIRKEPLEFEQYLNLRFGKYSTDESITSLAEFVVQKISPRHS EPVKRVLAVTETCLVERDPA

TYNIATLKPLGE VFALVCDSENPQLFTIEFIKGQVRKYSSTER RDSLLASLLDGVRASGNRDVCVKMAPTHKGQRWGLLSMPIDEEVESLHLRFLAAP

PN NGNFADAVFRFNANISYSGVLHAVTQD GLFSENKEKLINNAITALLSQEGDVVASNAELESQFQAVRRLVASKAGFLAFTQLPK KFRERLGMKVV

KALKRSNNGVIHAAVDMLCALMC PMHDDYDLRQEQLNKASLLSSKKFLENLLEKFNSHV DHGTGALVISSLLDFLTFALCAPYSETTEGQQFDMLLEM

VASNGRTLFKLFQ HPSMAIVKGAGLVMKAIIE - UNI4747 - EGDREIATKMQELALSEGALPRHLHTAMFTISSDQRMLTNR RQLSRHLVGLWT

ADNTTATNLLKRIL PPGLLAYLDSSDPVPEKDADRMHVRDNVKIAM DQYGKFNKVPEWQRLAGKAAKEVEKFA      

For any suggestions or comments, please send an email to unitrap@crg.es