Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054582 (1810053B01Rik)
Chromosomal location
Chr 2: 163851217 - 163876255 (+)
Description
RIKEN cDNA 1810053B01 gene Gene [Source:MGI Symbol;Acc:MGI:1922908]
RefSeq_peptide
NP_001107551.1 
UniGene
Mm.82301 
MGI
MGI:1922908 
Uniprot/SPTREMBL
A2A5N3 B2RXY9 
Human Ortholog
ENSG00000101104 (PABPC1L)
Omim not available
UniTrap UNI28556
Vector Insertion
Chr 2: 163875361 - 163875712
Public Clones not available
Private Clones OST28029 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067715
Sequence
ATGGACACAGGTGGCCATGGCTGCTCACTCTCCTCGCTCTATGTGGGCGATCTGCACCCCGACGTGACTGAATCTATGCTCTATGAGATGTTCTCCCCGA

TCGGCAATATCCTTTCCATCCGCGTGTGTCGGGATGTGGCTACCCGGCGCTCTCTGGGCTATGCCTACATCAATTTCCAGCAGCCTGCTGACG CGGAAC

GGGCACTAGACACAATGAACTTTGAGGTGATCAAAGGCCAGCCCATCCGAATCATGTGGTCCCACCGAGACCCAGGCCTTCGGAAGTCTGGTATGGGCAA

CATCTTTATCAAAAACTTGGAGAATTCCATCGACAACAAGGCTCTGTATGACACCTTCTCTACTTTTGGGAGCATTCTCTCTTCTAAG GTAGTATACAA

TGAACATGGATCGCGGGGTTTCGGCTTTGTGCATTTCGAGACCCACGAGGCTGCCCAGAAGGCCATCAACACCATGAATGGGATGTTGCTGAACGACCGG

AAAGT CTTTGTAGGCCATTTCAAGTCTCGACAGAAGCGGGAGGCAGAGCTGGGGGCTCGGGCCCTCGGGTTCACCAACATCTATGTGAAGAACCTGCAC

GCGAACGTGGACGAGCAGAGGCTCCAGGACCTCTTCTCCCAGTTTG GAAATATGCAGAGTGTGAAGGTGATGAGAGACAGCAATGGGCAATCCCGGGGC

TTCGGCTTTGTCAACTTTGAGAAGCATGAGGAAGCCCAGAAG GCCGTGGACCACATGAATGGGAAGGAGGTGAGCGGGCAGCTGCTCTATGTGGGTCGG

GCCCAGAAGCGGGCAGAACGGCAGAGCGAGCTGAAGCGCAGGTTTGAACAAATGAAGCAGGAGAGGCAGAACCGCTACCAG GGTGTGAACCTTTATGTG

AAGAACCTGGACGACTCCATTAATGATGAGAGGCTGAAGGAAGTTTTCTCTACCTATGGCGTGATCACCAGCGCTAAG GTGATGACAGAAAGTAGCCAC

AGCAAGGGCTTTGGCTTTGTGTGCTTTTCCTCTCCAGAAGAGGCAACGAAGGCCGTGACGGAGATGAACGGGCGCATCGTGGGCACGAAACCGCTCTATG

TGGCCCTGGCACAGCGCAAGGAGGAGCGGAAGGCCATCTTGACCAACCAGTATAGGCGACGCCCCTCTCACCCTGTCTTGAGCTCCTTCCAGCAGCCTAC

CAGCTACCTGCTCCCTGCTGTACCCCAG TCTACAGCCCAGGCTGTGTACTACAGTTCTGGCTCCATAACTCCAATGCAACCTGACCCCAGGTGGACAGC

CCAGCCACATGGACCTCCAT CTACCTGCCCTCCAGCTGCCTCTGTGGTCCAGCCTCTAAGCACGACGCAGCATCCCTGTATCCACCTGAGGGGTGCCAG

CCAGGTCTCCAGCCAGGTGCCTCACACGCAGAGAGTAG TCAACATTGGTACCCAGACTACAGGACCAGGTGGGGAGGGATCCTCTATCCCAGGCCAGCT

TCTCGTGCCACATAGAGGAACCTCAGCTGTACACAGTGCCCATGGG GTCCAGGAGTCGGCCGTGTATGTCCCTGGCCATCAGCCTCTGACTGTGTCCAT

GCTGGCCGCTGCACCCCTACACGAGCAAAAGCAGATGATTG GGGAGCGTCTCTACTCCCTCATCCACGATGCCTGCGCCCCACTGACTGGCAAGATCAC

GGGCATGCTGCTGGAGCTGGACAACCTGGAGCTTCTGTTATTGCTGGAGTCCCCAGAGTCCCTCCATGCCAAG - UNI28556 - ATAGAAGAGGCGG

TGGCAGTACTGCAGGTGCATCGAGAAATGGAGTCAACAGATAGGAACTGAACTCTGTGGGTTCCTGGGGATGGAAGGACCGACAGAGCGGCTGAGCTGCT

GGCTCTCTGGAGACTCCGTAGAGAACCCAGCGATCAAAAACCCACTGTGATGTGTTGGTGGCTTTGTCTGAAGCACCAGGGAGTTTGGTGAAGCTAAAGG

AGTCATAGGAGACTTGCAGTGGCTGGATGTTCTCACGCCTGGCTCCGTTCTGCCTGTCTGGAGGCCTGGTCTGCTGGTCCACCTTCTTGACTGAAGATTG

GGTGTTTTCCATATTCTGGGAACATTTTTTTCCCTCCACTCCCCCTCCCCCCACCCCCACTGAAAATGGAATCTTCACTCCCTTGACTACTTGATTACTG

CATTTCTGCTCTTGGTTCTAGCTGTGTGAACTCTAACTTCTTTCCTGATGGGGATCTCTGTGTTCTTGAGCTCTGATTATGTAATGAAGGCTGACACAGT

CCCCCTGCTGATCATTTTGCTTTATATATT
Translation
MDTGGHGCSLSSLYVGDLHPDVTESMLYEMFSPIGNILSIRVCRDVATRRSLGYAYINFQQPADA AERALDTMNFEVIKGQPIRIMWSHRDPGLRKSGM

GNIFIKNLENSIDNKALYDTFSTFGSILSSK VVYNEHGSRGFGFVHFETHEAAQKAINTMNGMLLNDRKV VFVGHFKSRQKREAELGARALGFTNIYV

KNLHANVDEQRLQDLFSQFG GNMQSVKVMRDSNGQSRGFGFVNFEKHEEAQK AVDHMNGKEVSGQLLYVGRAQKRAERQSELKRRFEQMKQERQNRYQ

 GVNLYVKNLDDSINDERLKEVFSTYGVITSAK VMTESSHSKGFGFVCFSSPEEATKAVTEMNGRIVGTKPLYVALAQRKEERKAILTNQYRRRPSHPV

LSSFQQPTSYLLPAVPQ STAQAVYYSSGSITPMQPDPRWTAQPHGPPS STCPPAASVVQPLSTTQHPCIHLRGASQVSSQVPHTQRVV VNIGTQTTG

PGGEGSSIPGQLLVPHRGTSAVHSAHG VQESAVYVPGHQPLTVSMLAAAPLHEQKQMIG GERLYSLIHDACAPLTGKITGMLLELDNLELLLLLESPE

SLHAK - UNI28556 - IEEAVAVLQVHREMESTDRN

For any suggestions or comments, please send an email to unitrap@crg.es