Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054594 (Oscar)
Chromosomal location
Chr 7: 3561415 - 3567759 (-)
Description
osteoclast associated receptor Gene [Source:MGI (curated);Acc:Oscar-001]
RefSeq_dna
NM_175632 
RefSeq_peptide
NP_783440.1 
UniGene
Mm.358882 
MGI
MGI:2179720 
Uniprot/SWISSPROT
Q8VBT3 
Uniprot/SPTREMBL
B2RQ61 
Human Ortholog
ENSG00000170909 (OSCAR)
Omim not available
UniTrap UNI33218
Vector Insertion
Chr 7: 3563185 - 3567119
Public Clones IST13383A9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108645
Sequence
GCTTTCTGGTGTTGCTTCATTTCCTCAGAGTGAAAAAGGCAGGGTCAACCTTTTCCTCAGCTCCACGGAGAGTGCCCACCATGGTCCTGTCGCTGATACT

CCAGCTGTCGACTCTCT - UNI33218 - GGCCTGCATGCCGTGCTGACTTCACACCAACAG - UNI33218 - CGCCCCTAGCCTCATACCCCCA

GCCATGGCTGGGAGCTCATCCTGCTGCAGTTGTGACTCCTGGGATCAACGTGACCTTGACTTGCCGCGCACCTCAATCTGCCTGGCGGTTTGCACTCTTC

AAAAGTGGCCTTGTCACCCCTCTGCTCCTCCGGGATGTGTCCGTTGAGCTGGCTGAGTTCTTCCTGGAAGAAGTGACTCCGGCCCAAGGGGGCAGTTATC

ACTGCCGCTACCGCAAGACAGACTGGGGGCCAGGTGTCTGGTCTCAGCCCAGTAATGTTCTGGAACTGCTGGTAACGG - UNI33218 - ATCAGCTC

CCCAGACCATCACTGGTGGCACTGCCTGGGCCTGTGGTGGCCCCGGGAGCCAACGTAAGCCTGCGCTGTGCAGGCCGCATACCGGGCATGAGTTTTGCAC

TGTACCGCGTAGGCGTGGCAACCCCTCTGCAGTATATTGACTCTGTGCAGCCCTGGGCTGACTTCCTTTTGATCGGCACACACACACCTGGCACCTACTG

TTGCTATTACCACACGCCTTCTGCCCCCTATGTGCTATCACAGCGCAGCCAGCCACTGGTCATCAGTTTCGAAG GTTCTGGCTCCTTGGACTATACCCA

GGGAAACCTCATCCGTTTGGGGCTGGCAGGAATGGTCCTCATCTGCTTGGGCATCATAGTTACTTGTGATTGGCACAGCAGGAGCTCTGCCTTTGATGGT

CTCCTGCCCCAGCAAAACTGAAGAGACTGCCTGGAGATGGACAGAGAAGCTGGGATCCTTGGTGACCAGCCCCTCTGAAACACTCTAGGCCTCCAGACTC

CACCAGATACTCATTCTTCACCACACTGTCAGGCTTGTTGAAGGATTAAAGGAAGTGACTGGCCTGTGGTAAATGATGTTCAGCTAATGTTAGTGACTTT

ATCCTCCCTTGAAAACCTCTATTTCCTTCCTGTGCCTTATTTCCGGCTCCCCACCTCTCCTTTCTTTTTCTTTCTGGCCGCGTTGGGATCATAGGTTCAT

TCTACCACACCCAGCAAAAATTTCTAATTCCATATTTTAAGGGTAATACCCAGGCCTCAGCCGTGTGTAGAGGCAAAAAAGACAACTTCCAGGAGTTGAT

TTTCTCTGTCCATCCTGTAGGTCCTAGGGTTTGAACTCAGGCTGCCAGGCTTAGCCACAACAACTTTACCCACTGAGCCATCTGGCTGGCTCCTAAGTAA

TTTATGTTTTTATATATATGAATGCTTTGCCTGTATGCATGTAGGCCTCGCTCCCCAAGGAAGCCAGAAGAAGGCATCTGATCTCTTGGAATTAGAGTTA

CAGATGGGTGTGAGCCACCATGTAGTGCTAGAAGCCCCAACCAAGGTCCTCTAGAAGAGTAGCCAGTACTCTTAACTGCTAAGCCATCTCTCCAAGGCCC

CCAAATCTATAAGATTAAAGTACTCATTCTCTCTTCTCTTCCAATGTTTTGGGGGTTTGTTCGTTTGTTTTTTAGTGCAATTTTTTAGTATTGAACCCAG

GTCCTTCTACGTGCTAGGCAAGTACTTTACCCTGTGCTACAATCCCATCTCCCAGGTAATTTTTAAAAAATTAATCATAAATTTTTGATGTTTTGGAAAC

AGTCTTATTCTGTAATGTAAAATGACTTGAACTTGAATAAATGTTCCTGCCTCAGCCTCTTGAATACCAAAA
Translation
MVLSLILQLSTLW - UNI33218 - WPACRADFTPTA - UNI33218 - APLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALFKSGLVT

PLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTD - UNI33218 - DQLPRPSLVALPGPVVAPGANVSLRCAGRIPG

MSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEG GSGSLDYTQGNLIRLGLAGMVLICLGIIVTCDWHSR

SSAFDGLLPQQN
Transcript ENSMUST00000039507
Sequence
TCAGAGTGAAAAAGGCAGGGTCAACCTTTTCCTCAGCTCCACGGAGAGTGCCCACCATGGTCCTGTCGCTGATACTCCAGCTGTCGACTCTCTGTGAGCT

GTCCCTCCCCT - UNI33218 - GGCCTGCATGCCGTGCTGACTTCACACCAACAG - UNI33218 - CGCCCCTAGCCTCATACCCCCAGCCATG

GCTGGGAGCTCATCCTGCTGCAGTTGTGACTCCTGGGATCAACGTGACCTTGACTTGCCGCGCACCTCAATCTGCCTGGCGGTTTGCACTCTTCAAAAGT

GGCCTTGTCACCCCTCTGCTCCTCCGGGATGTGTCCGTTGAGCTGGCTGAGTTCTTCCTGGAAGAAGTGACTCCGGCCCAAGGGGGCAGTTATCACTGCC

GCTACCGCAAGACAGACTGGGGGCCAGGTGTCTGGTCTCAGCCCAGTAATGTTCTGGAACTGCTGGTAACGG - UNI33218 - ATCAGCTCCCCAGA

CCATCACTGGTGGCACTGCCTGGGCCTGTGGTGGCCCCGGGAGCCAACGTAAGCCTGCGCTGTGCAGGCCGCATACCGGGCATGAGTTTTGCACTGTACC

GCGTAGGCGTGGCAACCCCTCTGCAGTATATTGACTCTGTGCAGCCCTGGGCTGACTTCCTTTTGATCGGCACACACACACCTGGCACCTACTGTTGCTA

TTACCACACGCCTTCTGCCCCCTATGTGCTATCACAGCGCAGCCAGCCACTGGTCATCAGTTTCGAAG GTTCTGGCTCCTTGGACTATACCCAGGGAAA

CCTCATCCGTTTGGGGCTGGCAGGAATGGTCCTCATCTGCTTGGGCATCATAGTTACTTGTGATTGGCACAGCAGGAGCTCTGCCTTTGATGGTCTCCTG

CCCCAGCAAAACTGAAGAGACTGCCTGGAGATGGACAGAGAAGCTGGGATCCTTGGTGACCAGCCCCTCTGAAACACTCTAGGCCTCCAGACTCCACCAG

ATACTCATTCTTCACCACACTGTCAGGCTTGTTGAAGGATTAAAGGAAGTGACTGGCCTGTGGTAAATGATGTTCAGCTAATGTTAGTGACTTTATCCTC

CCTTGAAAACCTCTATTTCCTTCCTGTGCCTTATTTCCGGCTCCCCACCTCTCCTTTCTTTTTCTTTCTGGCCGCGTTGGGATCATAGGTTCATTCTACC

ACACCCAGCAAAAATTTCTAATTCCATATTTTAAGGGTAATACCCAGGCCTCAGCCGTGTGTAGAGGCAAAAAAGACAACTTCCAGGAGTTGATTTTCTC

TGTCCATCCTGTAGGTCCTAGGGTTTGAACTCAGGCTGCCAGGCTTAGCCACAACAACTTTACCCACTGAGCCATCTGGCTGGCTCCTAAGTAATTTATG

TTTTTATATATATGAATGCTTTGCCTGTATGCATGTAGGCCTCGCTCCCCAAGGAAGCCAGAAGAAGGCATCTGATCTCTTGGAATTAGAGTTACAGATG

GGTGTGAGCCACCATGTAGTGCTAGAAGCCCCAACCAAGGTCCTCTAGAAGAGTAGCCAGTACTCTTAACTGCTAAGCCATCTCTCCAAGGCCCCCAAAT

CTATAAGATTAAAGTACTCATTCTCTCTTCTCTTCCAATGTTTTGGGGGTTTGTTCGTTTGTTTTTTAGTGCAATTTTTTAGTATTGAACCCAGGTCCTT

CTACGTGCTAGGCAAGTACTTTACCCTGTGCTACAATCCCATCTCCCAGGTAATTTTTAAAAAATTAATCATAAATTTTTGATGTTTTGGAAACAGTCTT

ATTCTGTAATGTAAAATGACTTGAACTTGAATAAATGTTCCTGCCTCAGCCTCTTGAATACC
Translation
MVLSLILQLSTLCELSLPW - UNI33218 - WPACRADFTPTA - UNI33218 - APLASYPQPWLGAHPAAVVTPGINVTLTCRAPQSAWRFALF

KSGLVTPLLLRDVSVELAEFFLEEVTPAQGGSYHCRYRKTDWGPGVWSQPSNVLELLVTD - UNI33218 - DQLPRPSLVALPGPVVAPGANVSLRC

AGRIPGMSFALYRVGVATPLQYIDSVQPWADFLLIGTHTPGTYCCYYHTPSAPYVLSQRSQPLVISFEG GSGSLDYTQGNLIRLGLAGMVLICLGIIVT

CDWHSRSSAFDGLLPQQN

For any suggestions or comments, please send an email to unitrap@crg.es