Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054598 (9130230L23Rik)
Chromosomal location
Chr 5: 66379167 - 66395524 (-)
Description
RIKEN cDNA 9130230L23 gene Gene [Source:MGI Symbol;Acc:MGI:3041166]
MGI
MGI:3041166 
Uniprot/SPTREMBL
Q8CC80 
Human Ortholog
not available
Omim not available
UniTrap UNI32681
Vector Insertion
Chr 5: 66392470 - 66395525
Public Clones IST12001C7 (tigm) IST12432G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16193
Vector Insertion
Chr 5: 66391695 - 66392122
Public Clones not available
Private Clones OST465278 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15887
Vector Insertion
Chr 5: 66381664 - 66391443
Public Clones IST12733E8 (tigm) IST14970H4 (tigm)
Private Clones OST470938 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067737
Sequence
AGAAAAGAAGGCAGAGCACCAGGTGGCAAGATCTGGGTGTGGCGAAAACTGCCTAGAGGGATAGAAGCCATCTAAG - UNI32681 - CCCCAGGCCA

TCTCAGCAAGGCTGCCAACAGGCTGCTGACACTGGACATTCTTCAACCTCTGGTGATTCCGAAGCTGTGAAAGCTCAAGGGACAGCTGGGAGAGTGCACT

GTGCCTACGAAGGGGCTGCTGGTCATTTCTTGGGCCTGTTAGGATTTCTCAAGAAAAAGGCTGGTAGGCATCTTCAAACCTCAGTTCCCTCTGCAGAG -

 UNI32681 - GTAAAAGAGGAAGCAAAGATACGGTTCTAAGGTTGCAGCCCACACTGTAAAGTGAACATGTGGTGACTGGATCCGGGTTCCTACTAAG

AACATG - UNI16193 - GACTAGGAAAAAGACCCTCATGAGAAGAGTCTAGCAGGAAGAAAATGGAAAGGTCATCTCTATCCAAATCTCAAGAGCTA

TGATTGGCTGAGCTAGCCCTGGGGTGATCCGTGAAATGAAGGGAAACCTGACTCCAATAACTGCTGCCAGGAGAAGCCTTGGGGGTGGAAGCCAAGCGTT

CAAATAAGAGGCGAAGTTGAGCAAGCATGGCAGTCCTCCAGCATTGGAAGGGACCAGATGCACCTGCCCAG - UNI15887 - CCTACCCCAGGAACC

AACCTGCTGTTACTCCTGGTTGATTGATCCCAGAGCTGATGGTCAGGCCCATGACTGGACTTCTTGTACCATACATGAACCCAGAGAAGACTTCTGCTTC

TCACTCAAAGTTGTATCTACTGTG GGAGGGTCTCACGATGTAGTCCAGACTGACCTCCGGCTTACGAAGCTCCTGCCTCCACTTCCGGTGTGTTGCAAT

TACAG GACTCTCAGGGTACAGGACTCAAGAGTCACATGTCAGAGGCCCAAGATTTCAATTAGCTTCGGCTTCTTATCAGCCTGCTCACCTCGGGACCTG

CTGCGTCCTAGTCCGCAAATGGGTTACAGAGAAAGGAGGCTCAAGCTACACTCTTCAGGACAGAGGCAGCACGGACTCAGCCAGACATGGAAGTTTCTAG

ACAGAGACCGTCAAAGTGCTGTTCTCCAAACCCAAAGAAAAAGATGGCTTCCATTGTGCCTGTGAAAATACTGAATCGTTCACCGTCTTAAGTCACGTCT

GGTTCCTTCTCCTTGCCCGGTGTCTTGCTCCTCTCGCTGCTCCACCTCCCGTTCCTCCTTCCTTCCATTTCGATCCTGGCTCCCACCAAGGTTCTCACAC

TCTAGAGTCCATGTATTTTTACCAGCTAAAGTCTGATTAGTGCAAACCCTAGCCATATGGAATATGCTTTTCTAAACCAAAGTCAATTCTTCCATCTGCT

GGGTCTCTTGAATGACGCACTCCTCGTTTGACTTGGGAATGTTAAAGTCCTGGGAATCCTGATCTTTGTCCTTTCAAGTAATAAAAAGAGGACAAATTTT

CTATTAATCCTC
Translation
 - UNI32681 -  - UNI32681 -  - UNI16193 - MHLPS - UNI15887 - SLPQEPTCCYSWLIDPRADGQAHDWTSCTIHEPREDFCF

SLKVVSTV GGSHDVVQTDLRLTKLLPPLPVCCNYR RTLRVQDSRVTCQRPKISISFGFLSACSPRDLLRPSPQMGYRERRLKLHSSGQRQHGLSQTWK

FLDRDRQSAVLQTQRKRWLPLCL

For any suggestions or comments, please send an email to unitrap@crg.es