Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054611 (Fbxl11)
Chromosomal location
Chr 19: 4316170 - 4398266 (-)
Description
F-box and leucine-rich repeat protein 11 Gene [Source:MGI Symbol;Acc:MGI:1354736]
RefSeq_dna
NM_001001984 
RefSeq_peptide
NP_001001984.2 
UniGene
Mm.471215 Mm.31941 
MGI
MGI:1354736 
Uniprot/SWISSPROT
P59997 
Uniprot/SPTREMBL
Q6DFY6 
Human Ortholog
ENSG00000173120 (FBXL11)
Omim not available
UniTrap UNI30016
Vector Insertion
Chr 19: 4396310 - 4398267
Public Clones D153D06 (ggtc) IST15014B1 (tigm) IST13602G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9872
Vector Insertion
Chr 19: 4394893 - 4396310
Public Clones XB538 (baygenomics) IST14619B8 (tigm)
Private Clones OST404073 (lexicon) OST262814 (lexicon) OST138772 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34394
Vector Insertion
Chr 19: 4365784 - 4394893
Public Clones IST10345F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17623
Vector Insertion
Chr 19: 4362915 - 4365156
Public Clones not available
Private Clones OST439530 (lexicon) OST415124 (lexicon) OST377254 (lexicon) OST371089 (lexicon)
OST319258 (lexicon) OST318812 (lexicon) OST301303 (lexicon) OST298158 (lexicon)
OST254053 (lexicon) OST240536 (lexicon) OST211150 (lexicon) OST184435 (lexicon)
OST183384 (lexicon) OST174794 (lexicon) OST171935 (lexicon) OST153417 (lexicon)
OST141114 (lexicon) OST73575 (lexicon) OST9654 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17515
Vector Insertion
Chr 19: 4362056 - 4362775
Public Clones not available
Private Clones OST441251 (lexicon) OST297268 (lexicon) OST168381 (lexicon) OST105243 (lexicon)
OST97319 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28027
Vector Insertion
Chr 19: 4361585 - 4361976
Public Clones not available
Private Clones OST42139 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33633
Vector Insertion
Chr 19: 4345517 - 4348762
Public Clones IST13045B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13020
Vector Insertion
Chr 19: 4331270 - 4342846
Public Clones E140E02 (ggtc) (ggtc) E050F01 (ggtc) E035C01 (ggtc) CMHD-GT_461B10-3 (cmhd)
CMHD-GT_338C8-3 (cmhd) CMHD-GT_261E4-3 (cmhd) PST10727-NR (escells) IST14293A12 (tigm)
IST14533F9 (tigm) IST12332G4 (tigm) IST13986B3 (tigm) IST14506A10 (tigm)
IST14377F6 (tigm)
Private Clones OST72664 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24752
Vector Insertion
Chr 19: 4329223 - 4331185
Public Clones E068E12 (ggtc) E113A08 (ggtc) (ggtc) E113A07 (ggtc) PST21389-NR (escells)
IST14725B11 (tigm) IST14260D4 (tigm)
Private Clones OST207917 (lexicon) OST147681 (lexicon) OST43753 (lexicon)
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2436
Vector Insertion
Chr 19: 4328260 - 4328952
Public Clones AC0251 (sanger) (sanger)
Private Clones OST37539 (lexicon)
Severity of mutation (?) Insertion after 53% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9375
Vector Insertion
Chr 19: 4325047 - 4326808
Public Clones XH003 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10003
Vector Insertion
Chr 19: 4322551 - 4324336
Public Clones XE085 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI677
Vector Insertion
Chr 19: 4319282 - 4320151
Public Clones DC0376 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047898
Sequence
CTAGAACCTGATGTAGAG - UNI34394 - CATATGCAATATTGGCAGAGACAG - UNI17623 - CGTGGTACCATGCGTCGTCGCTATGAAGAT

GATGGCATTTCAGATGATGAAATTGAAGGGAAAAGAACTTTTGACTTGGAAGAGAAGCTCCAAACCAACAAATATAATGCCAATTTTGTTACTTTTATGG

AGGGAAAAG - UNI17515 - ATTTTAATGTAGAGTATATCCAGCGGGGTGGCTTGAGAGACCCTCTCATTTTCAAGAATTCTGATGGACTTGGAATA

AA - UNI28027 - GATGCCGGATCCAGACTTCACAGTGAATGATGTCAAAATGTGTGTGG GGAGTCGTCGGATGGTGGATGTCATGGATGTGAACA

CACAGAAGGGGATTGAAATGACCATGGCACAATGGACACGATACTATGAGACTCCAGAGGAAGAGCGAGAAAAACTCTATAATGTTATCAGCCTAGAGTT

TAGCCACACCAGGCTTGAGAATATGGTGCAGCGGCCTTCCACG GTGGATTTCATTGACTGGGTAGATAACATGTGGCCAAGGCACTTGAAAGAAAGTCA

GACAGAATCAACAAATGCCATCTTAGAGATGCAGTACCCTAAAGTGCAAAA GTACTGTCTAATGAGTGTTCGAGGCTGCTATACTGACTTCCATGTGGA

TTTTGGAGGTACTTCTGTTTGGTATCACATCCACCAAGGTGGAAAG GTCTTCTGGCTCATCCCCCCTACAGCCCACAACCTGGAGCTGTACGAGAATTG

GCTGCTATCAGGGAAACAGGGAGACATCTTTCTGGGTGACCGGGTGTCAGATTGCCAACGAATTGAGCTCAAGCAGGGCTATACCTTCGTTATTCCCTCA

G - UNI33633 - GTTGGATTCATGCTGTGTATACTCCTACAGACACATTAGTGTTTGGAGGCAATTTTTTGCATAGCTTCAACATCCCCATGCAATT

AAAGATATACAGCATTGAAGATCGAACACGG - UNI33633 - GTTCCAAATAAATTCCGTTACCCATTTTACTATGAAATGTGTTGGTATGTGTTGG

AGCGCTATGTATACTGCATAACCAACCGATCCCACCTAACTAAGGATTTTCAGAAAGAATCCCTTAGCATGG - UNI33633 - ATATGGAGTTAAAT

GAGTTGGAGTCTGGAAATGGTGATGAGGAAGGGGTGGACAGAGAAGCCCGACGCATGAACAATAAGCGATCTGTGCTTACCAGCCCTGTTGCTAATGGAG

TGAACCTGGATTACGATGGACTTGGCAAAGCCTGCCGAAGTCTTCCAAGTCTGAAGAAAACTTTGTCTGGAGACTCATCCTCAGACTCTACCCGGGGATC

CCACAATGGCCAAGTTTGGGATCCCCAATGTAGCCCTAAAAAGGATAGGCAAGTGCATCTCACCCATTTTGAACTTGAAGGTCTTCGATGTCTTGTAGAT

AAGTTAGAGTCACTGCCACTGCACAAGAAGTGTGTCCCCACAGGAATAGAAGACGAAGATGCTCTGATTGCTGATGTAAAG - UNI13020 - ATTTT

GCTGGAAGAACTTGCCAGTAGCGATCCCAAGTTAGCCCTCACTGGAGTCCCTATAGTACAGTGGCCAAAAAGGGATAAG - UNI24752 - CTTAAAT

TCCCTACCAGGCCAAAGGTGAGGGTTCCTACAATTCCCATCACAAAGCCTCACACCATGAAGCCAGCTCCACGCTTAACACCTGTAAGGCCTGCTGCAGC

CTCCCCCATTGTGTCAGGAGCCAGGCGGAGAAGAGTGCGGTGCAGGAAATGCAAAGCTTGTGTGCAAGGAGAATGTGGAGTCTGCCACTACTGCAGGGAC

ATGAAGAAATTTGGTGGACCTGGACGCATGAAGCAATCCTGTGTCCTCCGACAGTGCTTAGCA - UNI2436 - CCCAGACTGCCTCATTCAGTTACG

TGTTCTCTCTGTGGAGAAGTAGATCAGAATGAAGAGACCCAGGACTTTGAAAAGAAACTCATGGAATGCTGCATCTGCAACGAGATAGTTCATCCTGGCT

GCCTCCAG ATGGATGGAGAGGGGTTGCTGAACGAGGAATTGCCAAATTGCTGGGAGTGTCCAAAGTGTTACCAGGAAGACAGCTCGGACAAAGCCCAG 

- UNI9375 - AAGCGGAAAATAGAAGAGAGTGATGAAGAAGCTGTACAAGCCAAAGTCTTACGGCCCCTGAGGAGCTGCGAGGAGCCTCTCACACCCC

CGCCTCACTCACCTACTTCCATGCTGCAGCTCATCCACGACCCGGTTTCTCCCCGGGGTATGGTGACTCGGTCATCCCCTGGGGCTGGCCCCAGCGACCA

CCACAGTGCCAGCCGTGATGAACGCTTCAAACGGCGGCAGTTGCTGCGGCTACAAGCCACCGAGCGCACCATGGTACGGGAAAAGGAGAACAATCCCAGC

GGCAAAAAGGAGCTGTCTGAAGTTGAGAAAGCCAAGATCCGGGGATCGTACCTCACTGTCACTCTACAGAGGCCCACCAAAGAGCTCCACGGGACATCCA

TTGTGCCCAAGCTGCAGGCCATCACGGCCTCCTCTGCCAACCTTCGCCCTAACCCCCGCGTGCTAATGCAGCACTGCCCAGCCCGAAACCCCCAGCATGG

GGATGAGGAGGGGCTTGGGGGAGAGGAGGAGGAAGAGGAGGAGGAGGAGGAAGATGACAGTGCAGAGGAGGGGGGTGCAGCCAGGCTGAATGGCCGGGGC

AGTTGGGCTCAGGATGGAGACGAAAGCTGGATGCAGCGGGAGGTCTGGATGTCTGTCTTCCGCTACCTCAGCCGCAAAGAACTTTGTGAATGTATGCGAG

TGTGCAAGACATGGTATAAATG - UNI10003 - GTGCTGTGATAAACGACTTTGGACAAAAATTGACTTGAGTAGGTGTAAGGCCATCGTACCACAA

GCTCTCAGTGGTATCATCAAGCGGCAGCCAGTAAGCCTCGACCTCAGCTGGACTAACATCTCCAAAAAGCAGCTGACATGGCTGGTCAATAGGCTGCCAG

 GATTAAAAGACCTCCTCCTAGCAGGCTGTTCCTGGTCTGCAGTATCTGCCCTCAGCACTTCCAGCTGCCCGCTTCTCAGGACCCTTGATCTTCGGTGGG

CAGTAGGAATTAAAGACCCTCAAATTCGGGACTTGCTGACTCCACCCACAGATAAGCCAG GTCAAGACAATCGAAGCAAACTCCGGAACATGACTGACT

TCCGGCTGGCAGGCCTTGACATCACAGATGCTACTCTCCGACTCATCATTCGCCACATGCCCCTTTTGTCTCGACTTGACCTCAGTCACTGCAGTCACCT

TACAGATCAGTCCTCCAACCTACTAACTGCTGTCGGGTCTTCCACTCGATACTCCCTTACAGAGCTCAATATGGCAG - UNI677 - GTTGCAATAAA

TTGACAGACCAGACCCTGTTCTTCCTAAGGCGAATTGCTAATGTCACCTTGATTGACCTTCGAGGATGCAAACAGATCACGAGAAAAGCCTGTGAGCACT

TCATCTCAGACTTGTCCATCAACAGCCTCTACTGCCTGTCTGATGAGAAACTGATACAGAAGATTAGCTAAGACATGCTCAGCCCAGACTGAACAGGAAA

ATCTTCCCCTGCCTTCCCACCAAGGAGAGTCTCTCCCTGACCCTGCGCAGGCTCTGAGGCCAACGACACATTCCCTCTCTGCTCTCTTTTCTCTGAGCCC

TTCTCCCACAGGTGGGGCAGAGAGGTTGGTGGACACCAAGGTTATTGCCTGCTCCTCTCCCTCCCACGGAAAAGAAAGGAGAGGTTGATCAAGGAGAAAG

CACAGGCTGTGCTATCCCAGTTCCTGCTTGCTTGCTCGTCTGCCAGCTAGGAAGCTGGGCTCTCAGTTTGGGGGAATTTGTGCATCTTTCACCTGCACTG

GGCCAAGAACCCTACCTTCTCACCCATAGTCCCTAGCAGTGCCTGGTTCTGAGCATACTCTAGGGAGGAAGGCAGCCTTGCCTCCATGGCCAGATTCTCC

TCATGGTGTCCGTTGCGTGTCTCTCCTCCGTTAAACTCTCCCGGCTTCTGCAGGAGGAGCCAACAGCCCTAGAAACACCAGGCCTGGCAGGTCTCAATGG

TGCTGTGAGTTGTCTGAAGCTTTGCTCCATGTCTGTCATAGCCCTTTTTTCTTGTCCCTGAGCTTGATGCTGTCCAACACTCATAATACAGTCCCCATTC

TGCCATCACCCCCTAAACTTTTCCACTAGTCACCCACTTGTCCTTTGTTGCACTTACTTGGGGTTATCAAAAGCTCTTCAGAGGAGCTGGAACTCTGCCC

CTCCCCCCCCCCCCCGAAATGCCCATATCATTGCTACCCAGGCATATTCTAAGACAGGCATCATTAATACTCCCCACCCATTGCTGCCCACCAACTGCCC

TTTTCCATTTGTCCTCTTTCTGCCTGAGCAGGGCTTTTCTAGAATTTGTGTCCTCAGAAGGAGCAGCATGTTTCTCCAGGTGGGGGAAACAGAAGACTGG

TTGAATCCCCACCTGCCTCTCTAAGCCAGGCTTTTCTGGGCTCTGGTTTAGCATGGCCCTCTGAGCCCAGGCCTGTGTATAACCTAGCAGCTCACTGACC

TGGTGCCTTTTAAGGGGAGTCCTGATTGAAAACCTACCCTCTGCCTGCAGCCTTGGAAGTGTGTGTGCATGTGCCTCTGTGTGTCTGGCTAAGTGTGCTG

CACATATGTGCAGGGAAGGAGGGGAGCATGATGGCTCCCACTCCTCATCGCCCTTCTTCAAGCCCCATCAAGCTGCCCCCTTTGACTTTGCATTGAACGG

CCTGTCCAAAGATCCTCTCTCTAGGGCAGCAGAGAGCTTTTTGCACTTTAGAAAAAAAAAAAAAATGAAAGAAAGAAAATGGTCGGAACTGTTCTGGGTC

AATATTTAGAGTATGAGGAGATGCTCAGCAGAGGCCTGTGGCCAGAGTTTGTCAGTGATACATGCAAATTTGCACTCTGCTCCCCATCTATAGGAGATTG

ATAATTGATAGCACAGCCTTGCCCCGCCTTCTCTTAGCCCCAAACATATCCCTTCCCACTTCCCACCCCATTTCCTGGAATCTAGCCTCAGACTTTCCTA

AACTCCATCAAGAGGGGACAGAGCCCGGGCACCATGAGTCTGAAGTGTGAACCGCCCAAGGAGAGATGCTAACTGTACCCTTGCCACTGCCAAAGCAATA

GAGGCAGAAGTGTCCCCTCTGCCACTCAGCCCAGCTTTGACCCTGGCAATAACCAGACTTTTTCCAGGAAAACTGGGTTTCTGGCAAGGGATGGCATTGT

TTCTTCCAATCTGCTGATTTCTCTTGGCTGCACCTTAAAAACAGCAGTCTGCTCCCTTGACCCTCTGCCATTCCATTGGTCTTCAGGTCCCAGAATCCTG

GGCCTGAAATGTTGAGGAAACGCCAGTGACTTATTCCAGAGTGCCTCAGTTGGGGGAACTTCTGTAAAGAACCCTGGGTGTTGAGCAAAAACCTTATTAA

TACTATTAATGACCTATAATTAGAAGCTTCCTGACTTTTTTTCTTTTTGGTTGCTCCTGTGGAAAATACTAAAATTACTAAGTTTTGTTTGTTGTCTTTT

TATGAAAGGGGAGGTGGAGAGACCCTTTCAGAGCAGGGATTGTGCCGGGAGAGTGCCTCTGCCCTTTGGGACAGTTCATCCACAGAAATTTCTAAGCTGA

TGGCTTGTCTGGGTTTTGGTCTTTGCATTTGAATTTAGAAAAAGCAAGCATTTTACCGCACAGAAATTTGTCAGTGGAAAAGGGAGCTCAGGGTGGTGGC

AGATGGACTGACGCCCTTGCTGGGTCTTTTCTTTAGGACTATGAGGGAGAATGGTTTTTAGAGGTGAGAGTTGGTCCTTGCAAAAAGAGAGAAGTGTCTC

CGAGGACGTAGAACATGCGAGTTCATAGTCCTGCATCTACTCTTAGCTGCAGTCTTGCCAGAGCCTGGCCTCAGACTGCAGGACCTGACCTCTGCCTTCA

TCTTTCCACATACTGGGGCAAAAAAACACAAAGGAAAGGAAGAAAATTATATATATATAATTATATATATATAATATAAAATCACTTGGTGATTAAAAAA

ATAACTGCTCAATAAATAAAACTCCTAAAGTCACTATGTTTAAAGGGTTTGGTTTTTTGGGGGTGGGTGGGAAATATTGTAAATATATATTTTTTGTTGC

TTATTTAGAGTCGATCTCCAATGTTGTGCTAAGATTTTTAAATTAAATGTAAGCATTAAGGGAATGAGTCTTAGGCCACCAGCTGACACATTGGCATTAT

TTTGGGTCAGGGAAGGAAGAAAGCTAGTTGGACTTTGTTTTCTAAAAGTTTCCCACTTGGTTTTAGAAAGAGCAAAGATGTCTTTCTTCTGACACTTGGG

AATGGGAGATATTTGTGTAATAAAATTTTTAAAAGACAAAAAAAGAAATAGCCTCCAATGGGAAATATTTTGATTTGGTTTTCTTTTTTGTTTTTGTTTT

T
Translation
LEPDVE - UNI34394 - HMQYWQRQ - UNI17623 - RGTMRRRYEDDGISDDEIEGKRTFDLEEKLQTNKYNANFVTFMEGKD - UNI17515

 - DFNVEYIQRGGLRDPLIFKNSDGLGIK - UNI28027 - KMPDPDFTVNDVKMCVG GSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKL

YNVISLEFSHTRLENMVQRPST VDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQK KYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGK VFWLIPP

TAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSG - UNI33633 - GWIHAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTR -

 UNI33633 - VPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMD - UNI33633 - DMELNELESGNGDEEGVDREARRMNNKRSVL

TSPVANGVNLDYDGLGKACRSLPSLKKTLSGDSSSDSTRGSHNGQVWDPQCSPKKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADV

K - UNI13020 - ILLEELASSDPKLALTGVPIVQWPKRDK - UNI24752 - LKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGA

RRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLA - UNI2436 - PRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHP

GCLQ MDGEGLLNEELPNCWECPKCYQEDSSDKAQ - UNI9375 - KRKIEESDEEAVQAKVLRPLRSCEEPLTPPPHSPTSMLQLIHDPVSPRGMVT

RSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRPNPRVLM

QHCPARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVFRYLSRKELCECMRVCKTWYKW - UNI10003 - W

CCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPG GLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRD

LLTPPTDKPG GQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYSLTELNMAG - UNI677 - GCNK

LTDQTLFFLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
Transcript ENSMUST00000116571
Sequence
CTGAGCGTGGCCAACAGCAGGGGCTCCCTGGGCCACCTCCCTGGGAGCCTGCGGCCCGCAGTGGGGTGTGCTAGCTGCTGCCACCCCTGAGCCGTCGTGG

ATCCCACTGTCGCGCACAGCACCTGTGGACTCCCTTGTCAAGCGTCTGGAGCTGCCCTGAGGGAACAGAGCTCGGGACAGACATGCTACTGCTACCGGTT

CCTGCCCCTTCGGAGCGGCGAGGAGTGGGTGAGGCGAAACCGGTTCGCTGCACGGACAGGAGCTCCCCCCGTGCTAAGGGCGGCCAGGCCCTGCAGCGGG

GGGCGCAGGGGCCTACTCCGGGATGGCGAGCAG - UNI9872 - - UNI30016 - - UNI34394 - GAAGAGGAAGGCATCCCTGGAGTGGTTT

CTTTACTGTACTTCCATCAGAAGAGTGAGAGATGGAACCTGAAGAAGAAAGGATTCGGTACAGCCAGAGATTG - UNI17623 - - UNI34394 - 

CGTGGTACCATGCGTCGTCGCTATGAAGATGATGGCATTTCAGATGATGAAATTGAAGGGAAAAGAACTTTTGACTTGGAAGAGAAGCTCCAAACCAACA

AATATAATGCCAATTTTGTTACTTTTATGGAGGGAAAAG - UNI17515 - ATTTTAATGTAGAGTATATCCAGCGGGGTGGCTTGAGAGACCCTCTC

ATTTTCAAGAATTCTGATGGACTTGGAATAAA - UNI28027 - GATGCCGGATCCAGACTTCACAGTGAATGATGTCAAAATGTGTGTGG GGAGTC

GTCGGATGGTGGATGTCATGGATGTGAACACACAGAAGGGGATTGAAATGACCATGGCACAATGGACACGATACTATGAGACTCCAGAGGAAGAGCGAGA

AAAACTCTATAATGTTATCAGCCTAGAGTTTAGCCACACCAGGCTTGAGAATATGGTGCAGCGGCCTTCCACG GTGGATTTCATTGACTGGGTAGATAA

CATGTGGCCAAGGCACTTGAAAGAAAGTCAGACAGAATCAACAAATGCCATCTTAGAGATGCAGTACCCTAAAGTGCAAAA GTACTGTCTAATGAGTGT

TCGAGGCTGCTATACTGACTTCCATGTGGATTTTGGAGGTACTTCTGTTTGGTATCACATCCACCAAGGTGGAAAG GTCTTCTGGCTCATCCCCCCTAC

AGCCCACAACCTGGAGCTGTACGAGAATTGGCTGCTATCAGGGAAACAGGGAGACATCTTTCTGGGTGACCGGGTGTCAGATTGCCAACGAATTGAGCTC

AAGCAGGGCTATACCTTCGTTATTCCCTCAG - UNI33633 - GTTGGATTCATGCTGTGTATACTCCTACAGACACATTAGTGTTTGGAGGCAATTT

TTTGCATAGCTTCAACATCCCCATGCAATTAAAGATATACAGCATTGAAGATCGAACACGG - UNI33633 - GTTCCAAATAAATTCCGTTACCCAT

TTTACTATGAAATGTGTTGGTATGTGTTGGAGCGCTATGTATACTGCATAACCAACCGATCCCACCTAACTAAGGATTTTCAGAAAGAATCCCTTAGCAT

GG - UNI33633 - ATATGGAGTTAAATGAGTTGGAGTCTGGAAATGGTGATGAGGAAGGGGTGGACAGAGAAGCCCGACGCATGAACAATAAGCGAT

CTGTGCTTACCAGCCCTGTTGCTAATGGAGTGAACCTGGATTACGATGGACTTGGCAAAGCCTGCCGAAGTCTTCCAAGTCTGAAGAAAACTTTGTCTGG

AGACTCATCCTCAGACTCTACCCGGGGATCCCACAATGGCCAAGTTTGGGATCCCCAATGTAGCCCTAAAAAGGATAGGCAAGTGCATCTCACCCATTTT

GAACTTGAAGGTCTTCGATGTCTTGTAGATAAGTTAGAGTCACTGCCACTGCACAAGAAGTGTGTCCCCACAGGAATAGAAGACGAAGATGCTCTGATTG

CTGATGTAAAG - UNI13020 - ATTTTGCTGGAAGAACTTGCCAGTAGCGATCCCAAGTTAGCCCTCACTGGAGTCCCTATAGTACAGTGGCCAAAA

AGGGATAAG - UNI24752 - CTTAAATTCCCTACCAGGCCAAAGGTGAGGGTTCCTACAATTCCCATCACAAAGCCTCACACCATGAAGCCAGCTCC

ACGCTTAACACCTGTAAGGCCTGCTGCAGCCTCCCCCATTGTGTCAGGAGCCAGGCGGAGAAGAGTGCGGTGCAGGAAATGCAAAGCTTGTGTGCAAGGA

GAATGTGGAGTCTGCCACTACTGCAGGGACATGAAGAAATTTGGTGGACCTGGACGCATGAAGCAATCCTGTGTCCTCCGACAGTGCTTAGCA - UNI2

436 - CCCAGACTGCCTCATTCAGTTACGTGTTCTCTCTGTGGAGAAGTAGATCAGAATGAAGAGACCCAGGACTTTGAAAAGAAACTCATGGAATGCT

GCATCTGCAACGAGATAGTTCATCCTGGCTGCCTCCAG ATGGATGGAGAGGGGTTGCTGAACGAGGAATTGCCAAATTGCTGGGAGTGTCCAAAGTGTT

ACCAGGAAGACAGCTCGGACAAAGCCCAG - UNI9375 - AAGCGGAAAATAGAAGAGAGTGATGAAGAAGCTGTACAAGCCAAAGTCTTACGGCCCC

TGAGGAGCTGCGAGGAGCCTCTCACACCCCCGCCTCACTCACCTACTTCCATGCTGCAGCTCATCCACGACCCGGTTTCTCCCCGGGGTATGGTGACTCG

GTCATCCCCTGGGGCTGGCCCCAGCGACCACCACAGTGCCAGCCGTGATGAACGCTTCAAACGGCGGCAGTTGCTGCGGCTACAAGCCACCGAGCGCACC

ATGGTACGGGAAAAGGAGAACAATCCCAGCGGCAAAAAGGAGCTGTCTGAAGTTGAGAAAGCCAAGATCCGGGGATCGTACCTCACTGTCACTCTACAGA

GGCCCACCAAAGAGCTCCACGGGACATCCATTGTGCCCAAGCTGCAGGCCATCACGGCCTCCTCTGCCAACCTTCGCCCTAACCCCCGCGTGCTAATGCA

GCACTGCCCAGCCCGAAACCCCCAGCATGGGGATGAGGAGGGGCTTGGGGGAGAGGAGGAGGAAGAGGAGGAGGAGGAGGAAGATGACAGTGCAGAGGAG

GGGGGTGCAGCCAGGCTGAATGGCCGGGGCAGTTGGGCTCAGGATGGAGACGAAAGCTGGATGCAGCGGGAGGTCTGGATGTCTGTCTTCCGCTACCTCA

GCCGCAAAGAACTTTGTGAATGTATGCGAGTGTGCAAGACATGGTATAAATG - UNI10003 - GTGCTGTGATAAACGACTTTGGACAAAAATTGAC

TTGAGTAGGTGTAAGGCCATCGTACCACAAGCTCTCAGTGGTATCATCAAGCGGCAGCCAGTAAGCCTCGACCTCAGCTGGACTAACATCTCCAAAAAGC

AGCTGACATGGCTGGTCAATAGGCTGCCAG GATTAAAAGACCTCCTCCTAGCAGGCTGTTCCTGGTCTGCAGTATCTGCCCTCAGCACTTCCAGCTGCC

CGCTTCTCAGGACCCTTGATCTTCGGTGGGCAGTAGGAATTAAAGACCCTCAAATTCGGGACTTGCTGACTCCACCCACAGATAAGCCAG GTCAAGACA

ATCGAAGCAAACTCCGGAACATGACTGACTTCCGGCTGGCAGGCCTTGACATCACAGATGCTACTCTCCGACTCATCATTCGCCACATGCCCCTTTTGTC

TCGACTTGACCTCAGTCACTGCAGTCACCTTACAGATCAGTCCTCCAACCTACTAACTGCTGTCGGGTCTTCCACTCGATACTCCCTTACAGAGCTCAAT

ATGGCAG - UNI677 - GTTGCAATAAATTGACAGACCAGACCCTGTTCTTCCTAAGGCGAATTGCTAATGTCACCTTGATTGACCTTCGAGGATGCA

AACAGATCACGAGAAAAGCCTGTGAGCACTTCATCTCAGACTTGTCCATCAACAGCCTCTACTGCCTGTCTGATGAGAAACTGATACAGAAGATTAGCTA

AGACATGCTCAGCCCAGACTGAACAGGAAAATCTTCCCCTGCCTTCCCACCAAGGAGAGTCTCTCCCTGACCCTGCGCAGGCTCTGAGGCCAACGACACA

TTCCCTCTCTGCTCTCTTTTCTCTGAGCCCTTCTCCCACAGGTGGGGCAGAGAGGTTGGTGGACACCAAGGTTATTGCCTGCTCCTCTCCCTCCCACGGA

AAAGAAAGGAGAGGTTGATCAAGGAGAAAGCACAGGCTGTGCTATCCCAGTTCCTGCTTGCTTGCTCGTCTGCCAGCTAGGAAGCTGGGCTCTCAGTTTG

GGGGAATTTGTGCATCTTTCACCTGCACTGGGCCAAGAACCCTACCTTCTCACCCATAGTCCCTAGCAGTGCCTGGTTCTGAGCATACTCTAGGGAGGAA

GGCAGCCTTGCCTCCATGGCCAGATTCTCCTCATGGTGTCCGTTGCGTGTCTCTCCTCCGTTAAACTCTCCCGGCTTCTGCAGGAGGAGCCAACAGCCCT

AGAAACACCAGGCCTGGCAGGTCTCAATGGTGCTGTGAGTTGTCTGAAGCTTTGCTCCATGTCTGTCATAGCCCTTTTTTCTTGTCCCTGAGCTTGATGC

TGTCCAACACTCATAATACAGTCCCCATTCTGCCATCACCCCCTAAACTTTTCCACTAGTCACCCACTTGTCCTTTGTTGCACTTACTTGGGGTTATCAA

AAGCTCTTCAGAGGAGCTGGAACTCTGCCCCTCCCCCCCCCCCCCGAAATGCCCATATCATTGCTACCCAGGCATATTCTAAGACAGGCATCATTAATAC

TCCCCACCCATTGCTGCCCACCAACTGCCCTTTTCCATTTGTCCTCTTTCTGCCTGAGCAGGGCTTTTCTAGAATTTGTGTCCTCAGAAGGAGCAGCATG

TTTCTCCAGGTGGGGGAAACAGAAGACTGGTTGAATCCCCACCTGCCTCTCTAAGCCAGGCTTTTCTGGGCTCTGGTTTAGCATGGCCCTCTGAGCCCAG

GCCTGTGTATAACCTAGCAGCTCACTGACCTGGTGCCTTTTAAGGGGAGTCCTGATTGAAAACCTACCCTCTGCCTGCAGCCTTGGAAGTGTGTGTGCAT

GTGCCTCTGTGTGTCTGGCTAAGTGTGCTGCACATATGTGCAGGGAAGGAGGGGAGCATGATGGCTCCCACTCCTCATCGCCCTTCTTCAAGCCCCATCA

AGCTGCCCCCTTTGACTTTGCATTGAACGGCCTGTCCAAAGATCCTCTCTCTAGGGCAGCAGAGAGCTTTTTGCACTTT
Translation
 - UNI9872 - - UNI30016 - - UNI34394 - MEPEEERIRYSQRL - UNI17623 - - UNI34394 - RGTMRRRYEDDGISDDEIEG

KRTFDLEEKLQTNKYNANFVTFMEGKD - UNI17515 - DFNVEYIQRGGLRDPLIFKNSDGLGIK - UNI28027 - KMPDPDFTVNDVKMCVG 

GSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPST VDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQK KY

CLMSVRGCYTDFHVDFGGTSVWYHIHQGGK VFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSG - UNI33633 - GWI

HAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTR - UNI33633 - VPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMD - UNI3

3633 - DMELNELESGNGDEEGVDREARRMNNKRSVLTSPVANGVNLDYDGLGKACRSLPSLKKTLSGDSSSDSTRGSHNGQVWDPQCSPKKDRQVHLT

HFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVK - UNI13020 - ILLEELASSDPKLALTGVPIVQWPKRDK - UNI24752 - LKFPT

RPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLA - UNI2436 - PR

LPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQ MDGEGLLNEELPNCWECPKCYQEDSSDKAQ - UNI9375 - KRKIEESDEEAVQA

KVLRPLRSCEEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYL

TVTLQRPTKELHGTSIVPKLQAITASSANLRPNPRVLMQHCPARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS

VFRYLSRKELCECMRVCKTWYKW - UNI10003 - WCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPG GLKDLL

LAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPTDKPG GQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQS

SNLLTAVGSSTRYSLTELNMAG - UNI677 - GCNKLTDQTLFFLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS
Transcript ENSMUST00000075856
Sequence
TGAGAATCTGACGGGTTCAAAATGGCGGCGGCTGCTTCAGCGGATCCTCCTGTGTGAGGGAAACAACACCCCTCCCCGGCAGCGGCGGCGGCGGCGGCGG

CGGGCCGCAGAGCACCTTTCCAGTTCCCGGGCCCGTCGCGGTTGTTTCCCTCCCGGGCAGTGGGCTCTTCGCGTGGAAGGGCAACGTCAGGGGGCCCATC

CCCCGGAGTCCCTCCTCTGCTACTGGGGAGTAGCTGGGGGTGTACGGGGGATCGTCCCGCAGCGCGGAGCCCCGGCTCAGGGGACGACGCAAAGGCAGCC

GAAGGCCCCCGGTCAGGGCGCTTCGCTGCTCCCGCCCTCTCCGCCCCCCGGGGCCGGGGCCCGCGTTCCGGGGGGCCGGGCGGCGCGGGGAGCGTCGGCC

GGGCGGGTCTCAGCTGATCGGCCGCGGTTCCTGGGCTTCGGTAGCGGCTGTGGCCGGCTGAGGGTACCGAGAGGAGGGTGTTTCCCGCGGCCCGGTTGAC

CCGGGTCTCGGGCTGGGGCTGCTGACCGCCAGCTTGGGGGAGTAGCCGAGTGGTCTTGCTTCCCTGACGCCTCGGACGCGGAGTCTGTAAAAGCCAGAAG

AGGAGGTTTGATTCAGTAACTGTTTCCTCTTTTCCGGGTCGCTCTGACCCTTCTCTGGATACTGGGTTAATACACAGAAATACCGAAGACGACGTTTGGG

ATTTTATTTTGTCTGTGTTTGGAATTTTACTTCTCTCTTGGACAAGAACTCAAGAACAAAATCCTCG - UNI9872 - - UNI30016 - - UNI34

394 - GAAGAGGAAGGCATCCCTGGAGTGGTTTCTTTACTGTACTTCCATCAGAAGAGTGAGAGATGGAACCTGAAGAAGAAAGGATTCGGTACAGCCA

GAGATTG - UNI17623 - - UNI34394 - CGTGGTACCATGCGTCGTCGCTATGAAGATGATGGCATTTCAGATGATGAAATTGAAGGGAAAAGA

ACTTTTGACTTGGAAGAGAAGCTCCAAACCAACAAATATAATGCCAATTTTGTTACTTTTATGGAGGGAAAAG - UNI17515 - ATTTTAATGTAGA

GTATATCCAGCGGGGTGGCTTGAGAGACCCTCTCATTTTCAAGAATTCTGATGGACTTGGAATAAA - UNI28027 - GATGCCGGATCCAGACTTCA

CAGTGAATGATGTCAAAATGTGTGTGG GGAGTCGTCGGATGGTGGATGTCATGGATGTGAACACACAGAAGGGGATTGAAATGACCATGGCACAATGGA

CACGATACTATGAGACTCCAGAGGAAGAGCGAGAAAAACTCTATAATGTTATCAGCCTAGAGTTTAGCCACACCAGGCTTGAGAATATGGTGCAGCGGCC

TTCCACG GTGGATTTCATTGACTGGGTAGATAACATGTGGCCAAGGCACTTGAAAGAAAGTCAGACAGAATCAACAAATGCCATCTTAGAGATGCAGTA

CCCTAAAGTGCAAAA GTACTGTCTAATGAGTGTTCGAGGCTGCTATACTGACTTCCATGTGGATTTTGGAGGTACTTCTGTTTGGTATCACATCCACCA

AGGTGGAAAG GTCTTCTGGCTCATCCCCCCTACAGCCCACAACCTGGAGCTGTACGAGAATTGGCTGCTATCAGGGAAACAGGGAGACATCTTTCTGGG

TGACCGGGTGTCAGATTGCCAACGAATTGAGCTCAAGCAGGGCTATACCTTCGTTATTCCCTCAG - UNI33633 - GTTGGATTCATGCTGTGTATA

CTCCTACAGACACATTAGTGTTTGGAGGCAATTTTTTGCATAGCTTCAACATCCCCATGCAATTAAAGATATACAGCATTGAAGATCGAACACGG - UN

I33633 - GTTCCAAATAAATTCCGTTACCCATTTTACTATGAAATGTGTTGGTATGTGTTGGAGCGCTATGTATACTGCATAACCAACCGATCCCACC

TAACTAAGGATTTTCAGAAAGAATCCCTTAGCATGG - UNI33633 - ATATGGAGTTAAATGAGTTGGAGTCTGGAAATGGTGATGAGGAAGGGGTG

GACAGAGAAGCCCGACGCATGAACAATAAGCGATCTGTGCTTACCAGCCCTGTTGCTAATGGAGTGAACCTGGATTACGATGGACTTGGCAAAGCCTGCC

GAAGTCTTCCAAGTCTGAAGAAAACTTTGTCTGGAGACTCATCCTCAGACTCTACCCGGGGATCCCACAATGGCCAAGTTTGGGATCCCCAATGTAGCCC

TAAAAAGGATAGGCAAGTGCATCTCACCCATTTTGAACTTGAAGGTCTTCGATGTCTTGTAGATAAGTTAGAGTCACTGCCACTGCACAAGAAGTGTGTC

CCCACAGGAATAGAAGACGAAGATGCTCTGATTGCTGATGTAAAG - UNI13020 - ATTTTGCTGGAAGAACTTGCCAGTAGCGATCCCAAGTTAGC

CCTCACTGGAGTCCCTATAGTACAGTGGCCAAAAAGGGATAAG - UNI24752 - CTTAAATTCCCTACCAGGCCAAAGGTGAGGGTTCCTACAATTC

CCATCACAAAGCCTCACACCATGAAGCCAGCTCCACGCTTAACACCTGTAAGGCCTGCTGCAGCCTCCCCCATTGTGTCAGGAGCCAGGCGGAGAAGAGT

GCGGTGCAGGAAATGCAAAGCTTGTGTGCAAGGAGAATGTGGAGTCTGCCACTACTGCAGGGACATGAAGAAATTTGGTGGACCTGGACGCATGAAGCAA

TCCTGTGTCCTCCGACAGTGCTTAGCA - UNI2436 - CCCAGACTGCCTCATTCAGTTACGTGTTCTCTCTGTGGAGAAGTAGATCAGAATGAAGAG

ACCCAGGACTTTGAAAAGAAACTCATGGAATGCTGCATCTGCAACGAGATAGTTCATCCTGGCTGCCTCCAG ATGGATGGAGAGGGGTTGCTGAACGAG

GAATTGCCAAATTGCTGGGAGTGTCCAAAGTGTTACCAGGAAGACAGCTCGGACAAAGCCCAG - UNI9375 - AAGCGGAAAATAGAAGAGAGTGAT

GAAGAAGCTGTACAAGCCAAAGTCTTACGGCCCCTGAGGAGCTGCGAGGAGCCTCTCACACCCCCGCCTCACTCACCTACTTCCATGCTGCAGCTCATCC

ACGACCCGGTTTCTCCCCGGGGTATGGTGACTCGGTCATCCCCTGGGGCTGGCCCCAGCGACCACCACAGTGCCAGCCGTGATGAACGCTTCAAACGGCG

GCAGTTGCTGCGGCTACAAGCCACCGAGCGCACCATGGTACGGGAAAAGGAGAACAATCCCAGCGGCAAAAAGGAGCTGTCTGAAGTTGAGAAAGCCAAG

ATCCGGGGATCGTACCTCACTGTCACTCTACAGAGGCCCACCAAAGAGCTCCACGGGACATCCATTGTGCCCAAGCTGCAGGCCATCACGGCCTCCTCTG

CCAACCTTCGCCCTAACCCCCGCGTGCTAATGCAGCACTGCCCAGCCCGAAACCCCCAGCATGGGGATGAGGAGGGGCTTGGGGGAGAGGAGGAGGAAGA

GGAGGAGGAGGAGGAAGATGACAGTGCAGAGGAGGGGGGTGCAGCCAGGCTGAATGGCCGGGGCAGTTGGGCTCAGGATGGAGACGAAAGCTGGATGCAG

CGGGAGGTCTGGATGTCTGTCTTCCGCTACCTCAGCCGCAAAGAACTTTGTGAATGTATGCGAGTGTGCAAGACATGGTATAAATG - UNI10003 - 

GTGCTGTGATAAACGACTTTGGACAAAAATTGACTTGAGTAGGTGTAAGGCCATCGTACCACAAGCTCTCAGTGGTATCATCAAGCGGCAGCCAGTAAGC

CTCGACCTCAGCTGGACTAACATCTCCAAAAAGCAGCTGACATGGCTGGTCAATAGGCTGCCAG GATTAAAAGACCTCCTCCTAGCAGGCTGTTCCTGG

TCTGCAGTATCTGCCCTCAGCACTTCCAGCTGCCCGCTTCTCAGGACCCTTGATCTTCGGTGGGCAGTAGGAATTAAAGACCCTCAAATTCGGGACTTGC

TGACTCCACCCACAGATAAGCCAG GTCAAGACAATCGAAGCAAACTCCGGAACATGACTGACTTCCGGCTGGCAGGCCTTGACATCACAGATGCTACTC

TCCGACTCATCATTCGCCACATGCCCCTTTTGTCTCGACTTGACCTCAGTCACTGCAGTCACCTTACAGATCAGTCCTCCAACCTACTAACTGCTGTCGG

GTCTTCCACTCGATACTCCCTTACAGAGCTCAATATGGCAG - UNI677 - GTTGCAATAAATTGACAGACCAGACCCTGTTCTTCCTAAGGCGAATT

GCTAATGTCACCTTGATTGACCTTCGAGGATGCAAACAGATCACGAGAAAAGCCTGTGAGCACTTCATCTCAGACTTGTCCATCAACAGCCTCTACTGCC

TGTCTGATGAGAAACTGATACAGAAGATTAGCTAAGACATGCTCAGCCCAGACTGAACAGGAAAATCTTCCCCTGCCTTCCCACCAAGGAGAGTCTCTCC

CTGACCCTGCGCAGGCTCTGAGGCCAACGACACATTCCCTCTCTGCTCTCTTTTCTCTGAGCCCTTCTCCCACAGGTGGGGCAGAGAGGTTGGTGGACAC

CAAGGTTATTGCCTGCTCCTCTCCCTCCCACGGAAAAGAAAGGAGAGGTTGATCAAGGAGAAAGCACAGGCTGTGCTATCCCAGTTCCTGCTTGCTTGCT

CGTCTGCCAGCTAGGAAGCTGGGCTCTCAGTTTGGGGGAATTTGTGCATCTTTCACCTGCACTGGGCCAAGAACCCTACCTTCTCACCCATAGTCCCTAG

CAGTGCCTGGTTCTGAGCATACTCTAGGGAGGAAGGCAGCCTTGCCTCCATGGCCAGATTCTCCTCATGGTGTCCGTTGCGTGTCTCTCCTCCGTTAAAC

TCTCCCGGCTTCTGCAGGAGGAGCCAACAGCCCTAGAAACACCAGGCCTGGCAGGTCTCAATGGTGCTGTGAGTTGTCTGAAGCTTTGCTCCATGTCTGT

CATAGCCCTTTTTTCTTGTCCCTGAGCTTGATGCTGTCCAACACTCATAATACAGTCCCCATTCTGCCATCACCCCCTAAACTTTTCCACTAGTCACCCA

CTTGTCCTTTGTTGCACTTACTTGGGGTTATCAAAAGCTCTTCAGAGGAGCTGGAACTCTGCCCCTCCCCCCCCCCCCCGAAATGCCCATATCATTGCTA

CCCAGGCATATTCTAAGACAGGCATCATTAATACTCCCCACCCATTGCTGCCCACCAACTGCCCTTTTCCATTTGTCCTCTTTCTGCCTGAGCAGGGCTT

TTCTAGAATTTGTGTCCTCAGAAGGAGCAGCATGTTTCTCCAGGTGGGGGAAACAGAAGACTGGTTGAATCCCCACCTGCCTCTCTAAGCCAGGCTTTTC

TGGGCTCTGGTTTAGCATGGCCCTCTGAGCCCAGGCCTGTGTATAACCTAGCAGCTCACTGACCTGGTGCCTTTTAAGGGGAGTCCTGATTGAAAACCTA

CCCTCTGCCTGCAGCCTTGGAAGTGTGTGTGCATGTGCCTCTGTGTGTCTGGCTAAGTGTGCTGCACATATGTGCAGGGAAGGAGGGGAGCATGATGGCT

CCCACTCCTCATCGCCCTTCTTCAAGCCCCATCAAGCTGCCCCCTTTGACTTTGCATTGAACGGCCTGTCCAAAGATCCTCTCTCTAGGGCAGCAGAGAG

CTTTTTGCACTTTAGAAAAAAAAAAAAAATGAAAGAAAGAAAATGGTCGGAACTGTTCTGGGTCAATATTTAGAGTATGAGGAGATGCTCAGCAGAGGCC

TGTGGCCAGAGTTTGTCAGTGATACATGCAAATTTGCACTCTGCTCCCCATCTATAGGAGATTGATAATTGATAGCACAGCCTTGCCCCGCCTTCTCTTA

GCCCCAAACATATCCCTTCCCACTTCCCACCCCATTTCCTGGAATCTAGCCTCAGACTTTCCTAAACTCCATCAAGAGGGGACAGAGCCCGGGCACCATG

AGTCTGAAGTGTGAACCGCCCAAGGAGAGATGCTAACTGTACCCTTGCCACTGCCAAAGCAATAGAGGCAGAAGTGTCCCCTCTGCCACTCAGCCCAGCT

TTGACCCTGGCAATAACCAGACTTTTTCCAGGAAAACTGGGTTTCTGGCAAGGGATGGCATTGTTTCTTCCAATCTGCTGATTTCTCTTGGCTGCACCTT

AAAAACAGCAGTCTGCTCCCTTGACCCTCTGCCATTCCATTGGTCTTCAGGTCCCAGAATCCTGGGCCTGAAATGTTGAGGAAACGCCAGTGACTTATTC

CAGAGTGCCTCAGTTGGGGGAACTTCTGTAAAGAACCCTGGGTGTTGAGCAAAAACCTTATTAATACTATTAATGACCTATAATTAGAAGCTTCCTGACT

TTTTTTCTTTTTGGTTGCTCCTGTGGAAAATACTAAAATTACTAAGTTTTGTTTGTTGTCTTTTTATGAAAGGGGAGGTGGAGAGACCCTTTCAGAGCAG

GGATTGTGCCGGGAGAGTGCCTCTGCCCTTTGGGACAGTTCATCCACAGAAATTTCTAAGCTGATGGCTTGTCTGGGTTTTGGTCTTTGCATTTGAATTT

AGAAAAAGCAAGCATTTTACCGCACAGAAATTTGTCAGTGGAAAAGGGAGCTCAGGGTGGTGGCAGATGGACTGACGCCCTTGCTGGGTCTTTTCTTTAG

GACTATGAGGGAGAATGGTTTTTAGAGGTGAGAGTTGGTCCTTGCAAAAAGAGAGAAGTGTCTCCGAGGACGTAGAACATGCGAGTTCATAGTCCTGCAT

CTACTCTTAGCTGCAGTCTTGCCAGAGCCTGGCCTCAGACTGCAGGACCTGACCTCTGCCTTCATCTTTCCACATACTGGGGCAAAAAAACACAAAGGAA

AGGAAGAAAATTATATATATATAATTATATATATATAATATAAAATCACTTGGTGATTAAAAAAATAACTGCTCAATAAATAAAACTCCTAAAGTCACTA

TGTTTAAAGGGTTTGGTTTTTTGGGGGTGGGTGGGAAATATTGTAAATATATATTTTTTGTTGCTTATTTAGAGTCGATCTCCAATGTTGTGCTAAGATT

TTTAAATTAAATGTAAGCATTAAGGGAATGAGTCTTAGGCCACCAGCTGACACATTGGCATTATTTTGGGTCAGGGAAGGAAGAAAGCTAGTTGGACTTT

GTTTTCTAAAAGTTTCCCACTTGGTTTTAGAAAGAGCAAAGATGTCTTTCTTCTGACACTTGGGAATGGGAGATATTTGTGTAATAAAATTTTTAAAAGA

CAAAAAAAGAAATAGCCTCCAATGGGAAATATTTTGATTTGGTTTTCTTTTTTGTTTTTGTTTTT
Translation
 - UNI9872 - - UNI30016 - - UNI34394 - MEPEEERIRYSQRL - UNI17623 - - UNI34394 - RGTMRRRYEDDGISDDEIEG

KRTFDLEEKLQTNKYNANFVTFMEGKD - UNI17515 - DFNVEYIQRGGLRDPLIFKNSDGLGIK - UNI28027 - KMPDPDFTVNDVKMCVG 

GSRRMVDVMDVNTQKGIEMTMAQWTRYYETPEEEREKLYNVISLEFSHTRLENMVQRPST VDFIDWVDNMWPRHLKESQTESTNAILEMQYPKVQK KY

CLMSVRGCYTDFHVDFGGTSVWYHIHQGGK VFWLIPPTAHNLELYENWLLSGKQGDIFLGDRVSDCQRIELKQGYTFVIPSG - UNI33633 - GWI

HAVYTPTDTLVFGGNFLHSFNIPMQLKIYSIEDRTR - UNI33633 - VPNKFRYPFYYEMCWYVLERYVYCITNRSHLTKDFQKESLSMD - UNI3

3633 - DMELNELESGNGDEEGVDREARRMNNKRSVLTSPVANGVNLDYDGLGKACRSLPSLKKTLSGDSSSDSTRGSHNGQVWDPQCSPKKDRQVHLT

HFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVK - UNI13020 - ILLEELASSDPKLALTGVPIVQWPKRDK - UNI24752 - LKFPT

RPKVRVPTIPITKPHTMKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLA - UNI2436 - PR

LPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQ MDGEGLLNEELPNCWECPKCYQEDSSDKAQ - UNI9375 - KRKIEESDEEAVQA

KVLRPLRSCEEPLTPPPHSPTSMLQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSEVEKAKIRGSYL

TVTLQRPTKELHGTSIVPKLQAITASSANLRPNPRVLMQHCPARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMS

VFRYLSRKELCECMRVCKTWYKW - UNI10003 - WCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWTNISKKQLTWLVNRLPG GLKDLL

LAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDLLTPPTDKPG GQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQS

SNLLTAVGSSTRYSLTELNMAG - UNI677 - GCNKLTDQTLFFLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDEKLIQKIS

For any suggestions or comments, please send an email to unitrap@crg.es