Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054679 (Srrp)
Chromosomal location
Chr 4: 33295966 - 33320315 (+)
Description
serine-arginine repressor protein Gene [Source:MGI (curated);Acc:Srrp-001]
RefSeq_dna
NM_177774 
RefSeq_peptide
NP_808442.1 
UniGene
Mm.156636 Mm.407978 
MGI
MGI:2661424 
Uniprot/SPTREMBL
A3KG57 A3KG58 Q8C8K3 
Human Ortholog
ENSG00000154548 (RP11-63L7.3)
Omim not available
UniTrap UNI30910
Vector Insertion
Chr 4: 33313145 - 33317898
Public Clones IST12482F10 (tigm) IST11589H11 (tigm) IST10886H6 (tigm) IST11430D8 (tigm)
IST11640B4 (tigm) IST10928A11 (tigm) IST14869D1 (tigm) IST14522F10 (tigm)
IST11512A4 (tigm) IST13719B10 (tigm) IST11430B3 (tigm) IST13533C5 (tigm)
IST13191F11 (tigm) IST14601E9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108159
Sequence
GGAGGGGGCGCGGCGGGCTGCTGGGAGCGGGGCCGCGAGAGGCATGTCTCGCTACACCAGGCCCCCCAACACCTCCCTGTTCGTCAGGAACGTCGCAGAC

GCCACCAG GCCCGAGGACTTGCGCCGTGAGTTTGGCCGATATGGCCCCATAGTAGACGTTTATATCCCATTGGACTTCTACAGTCGCCGCCCCAGAGGA

TTTGCTTATGTTCA GTTTGAAGATGTTCGGGATGCTGAAGACGCACTTTACAACCTCAACAGGAAGTGGGTATGTGGCCGGCAAATTGAAATACAGTTT

GCACAAGGTGATCGCAAAA CACCAGGCCAAATGAAGTCAAAAGAACGCCACCTGTGCTCCCCGAGTGACCACAGGAGATCCAGAAGCCCCAGCCAGAGG

AGATCGCGCAGCCGGAGTTCTTCATGGGGAAGAGACCGGAGGCACTCGGACAGCCTGAAAGA - UNI30910 - GTCTCGGCACAGGCGGTCTTCTTA

CAGTCAGTCTAAATCTCGTTCCAAATCGCTACCCAGGCAGTCTACCTCCCTGAGGCAGTCACGGACACCGAGAAGGAATTCTGGATCCAGAGGACGATCA

AGATCCAAGTCCTTACCCAAAAGGTCCAAGTCGATGGAGAAATCACAGTCACGCTCGCCTCAAAAGCAGACTGGCTCCGGAGCAAAGTCCAGACCACATG

GACGACACTGTGACTCCATAGCAAGATCCCCATGCAAGTCTCCCAGAGCGTACACCAGTTCTGGATCGAAGACACAGACAACAAAACACTCCCATCTCCG

GTCCCACTCCAGATCTCGGAGTTACCACCATAAAAACAGTTGGTGA
Translation
MSRYTRPPNTSLFVRNVADATR RPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYVQ QFEDVRDAEDALYNLNRKWVCGRQIEIQFAQGDRKT TPG

QMKSKERHLCSPSDHRRSRSPSQRRSRSRSSSWGRDRRHSDSLKE - UNI30910 - ESRHRRSSYSQSKSRSKSLPRQSTSLRQSRTPRRNSGSRGR

SRSKSLPKRSKSMEKSQSRSPQKQTGSGAKSRPHGRHCDSIARSPCKSPRAYTSSGSKTQTTKHSHLRSHSRSRSYHHKNSW
Transcript ENSMUST00000067864
Sequence
GAGTTGATCTCTTTAGGGAAAGGCTGTGGCTAAGCTTGCATGCCCACAAGTGGCTCCCTGACCCTGCACATGGCTCTTTCGAAGCCCTGTCATGAGATCT

TTTTCTGGGGCTGTTTGGGAGAGGCAGGTCTCCCTTGGAGCACCTAGCTGGCCTGCAGCGATGGGGGATCGGATCTATTCCCTAGAGGCCCGGGCAGTGG

CAAGGTCTGTGCTCGCGCGGCCGCGCAGGCCCCGCGCCCCCCGCCCGCGTCTGCGGCTGCGCGGCCGGCCCGGGAGGGGGCGCGGCGGGCTGCTGGGAGC

GGGGCCGCGAGAGGCATGTCTCGCTACACCAGGCCCCCCAACACCTCCCTGTTCGTCAGGAACGTCGCAGACGCCACCAG CACCAGGCCAAATGAAGTC

AAAAGAACGCCACCTGTGCTCCCCGAGTGACCACAGGAGATCCAGAAGCCCCAGCCAGAGGAGATCGCGCAGCCGGAGTTCTTCATGGGGAAGAGACCGG

AGGCACTCGGACAGCCTGAAAGA - UNI30910 - GTCTCGGCACAGGCGGTCTTCTTACAGTCAGTCTAAATCTCGTTCCAAATCGCTACCCAGGCA

GTCTACCTCCCTGAGGCAGTCACGGACACCGAGAAGGAATTCTGGATCCAGAGGACGATCAAGATCCAAGTCCTTACCCAAAAGGTCCAAGTCGATGGAG

AAATCACAGTCACGCTCGCCTCAAAAGCAGACTGGCTCCGGAGCAAAGTCCAGACCACATGGACGACACTGTGACTCCATAGCAAGATCCCCATGCAAGT

CTCCCAGAGCGTACACCAGTTCTGGATCGAAGACACAGACAACAAAACACTCCCATCTCCGGTCCCACTCCAGATCTCGGAGTTACCACCATAAAAACAG

TTGGTGAGGAGCTCCTCCCAGCAGAGCCGCAGAGCTCTGCTCCAAGCTCTCACACCTCGCTGTGGTTAAAGTGCTTCAAGGCCCGTAGAAATGCGAACCG

ATGGTAGCCACTTCACTTTGGGCATGTGGAAGGAATAAAATCGCCCTAGCTTTGGTTAATAAATGTTTTATCACGATTTAAGGGCTCATCCACAACTCAC

TCACTGTGTGTGCAATGTCGCCATTGCATAGCCTGTACCTGGTTCACCGGGCAGCGAGGGGTACTTTCTGAAAGATATCAGTAAAATAGAACCAATGCAA

AAATTCTACTTAGGTATTAAATATTGCCAATAATATCCTTTACCAAAATATTTTTTATTCTAAAGCACTTTTCACATAAAAAATAATCGTGACTATATGT

AATTGAATAGGCCAGAGACTTAAACTGTTTTGACATCTGTGTCTTTCTTGTGACTACTTCTGTTTAAGCTCAGGACAGAAGTATCCCAGTCTATTCTAGT

TCAAGTTACAGCATTCTGAAATCTGAAAAGGTAAAATCTATATGGCGATTCCATAGCCGTTTAAAAGATAGCTAGAAGGTATTTAAAAGATAACTCAAAG

ACCATTTCATTGTTTTTGAACACAACAGCACAGACCAGTTGACATGAAATTGTTATCCATGTTTGCTTAAACTGCTTAAAGAGAGCCGGGTGTTGGCTCA

GGCCTGTGACCCCAGCCCTTGGGAGGTGGAAGAGTTAAGCCAGCATGGACTGGGCTACGTGGGACCCTGTCTAAGGAAAATCAATGAATGCTTTTTTAAA

AAAAAGTGAAACCATTTTAGAAGTTCTAGATTTTGAATGGCTTGAGACTACTCTAGAAATTATGGTGTGGGACACTCAGACTCCACAAAATAAACTCATG

TTAAGCCTTACATATTTGAAGTACAGTACATTTTGTATAAATTCATATTTATATCATTATTTCTATATAGCTATTTTCATCTGCATTTTTTTCTTTTTAG

AGCTCTAGTTCAATATCCTAATTATATAAAAGTCTTTTAAAAAATTAAACACAGTACATTATATTAAGAAGTACTAGCTAATGAGATGGCCTGGGGGGGG

AGGGGTTAAACCCACACACCATCCAAACCTGGCAACCGAGAGCTAGCTGGGCAATGAGTGCAAACCCTGGAACCCACAAGGGTGACTCCTGCAGACTCTC

TCTGACTTCCACACTTGTAGTATGGCACGTGTGCACCTGAAGACAGACAGACAGACACACACAGGTGCACATTAAATGTATGCAAAACATTTAAGGTCGA

AACTACACCTTCAAGCCAGATAGGTAGCACATGCCTGTCACCTCAGCAGCACTCAGGAAGCTGAGGCAGGAATTTGAGAAAAGCTTGGGAAATTTTGAGA

CCCATCACACTCACACTCAGGTGCATGCACGCACGCGCGCGCGCGTGCACACACACACACACACACACAGGAGAGAGAGACAGACAGAGAGACAGAGACA

GAGAAAGAGGGGGTCTTCATAAACAGCTTTAAGGTATTTGACTTTTACTCTACATTTTGTAAACCAAATAACTTTGTTGGCAATTGTTGCTTTTGTATTG

TCGTATCTTAGAATTTCTTTTACAATGTGTTTTGAGGTTTACATTCAGACAGTTTTAGTAGATCTGTGATAAAAATGGTTTGCAAATATAATTGTCAAAG

AGATATGTTTACAGATTTACTCTGTTAGATCTCATTACTAAAACACACTGTCAGTCCCTACAGCTAATATTTATGCCTGGAATACCTAAGAAACCTGTCT

TACATTTTCAGTATTTGGAGCCATGTTGCTTCTATCAATTTCAAATACAAAGTTCCATTTTTCTTTGCATTTTAAAATCCTTTATGTGAGAAACAACTTT

ACAAAATGATTTGTACATTGGTGATATTTGAAGAAGTACCACAAATTAATGTATATTATACTCCCCGAATATATTTTCTCTATTTAACCATAGCAAAAGT

TATTTATTTCAAAAGTTCCCTCTGGTGTTCCTCTGTAATAAAGCAATTGTAACG
Translation
MRSFSGAVWERQVSLGAPSWPAAMGDRIYSLEARAVARSVLARPRRPRAPRPRLRLRGRPGRGRGGLLGAGPREACLATPGPPTPPCSSGTSQTPPA AP

GQMKSKERHLCSPSDHRRSRSPSQRRSRSRSSSWGRDRRHSDSLKE - UNI30910 - ESRHRRSSYSQSKSRSKSLPRQSTSLRQSRTPRRNSGSRG

RSRSKSLPKRSKSMEKSQSRSPQKQTGSGAKSRPHGRHCDSIARSPCKSPRAYTSSGSKTQTTKHSHLRSHSRSRSYHHKNSW

For any suggestions or comments, please send an email to unitrap@crg.es