Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054708 (Ankrd24)
Chromosomal location
Chr 10: 81091380 - 81110355 (+)
Description
ankyrin repeat domain 24 Gene [Source:MGI (curated);Acc:Ankrd24-001]
RefSeq_dna
NM_027480 
RefSeq_peptide
NP_081756.3 
UniGene
Mm.304382 
MGI
MGI:1890394 
Uniprot/SWISSPROT
Q80VM7 
Uniprot/SPTREMBL
Q69Z50 Q8VD21 Q9CYE0 Q9D2N5 
Human Ortholog
ENSG00000089847 (ANKRD24)
Omim not available
UniTrap UNI30832
Vector Insertion
Chr 10: 81105165 - 81105261
Public Clones IST14809F10 (tigm) IST14687C9 (tigm) IST12511B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32855
Vector Insertion
Chr 10: 81106639 - 81109049
Public Clones IST12077D9 (tigm) IST14637A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20707
Vector Insertion
Chr 10: 81109049 - 81109179
Public Clones not available
Private Clones OST354120 (lexicon) OST321074 (lexicon) OST188885 (lexicon) OST165421 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19665
Vector Insertion
Chr 10: 81109604 - 81109844
Public Clones not available
Private Clones OST384147 (lexicon) OST237361 (lexicon) OST168061 (lexicon) OST103506 (lexicon)
OST96675 (lexicon) OST47009 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092277
Sequence
ATGAAGCAGCTGTGCCTGTGTGCTGCTGCCTCCTTCGCG CTCCGGCTCAGCCCCACCGACCTCAGCTCCTGCCCACCCTGTGGCCGGTGCCCTATCCCA

AAACCCGCAGCCAGAGGCAGGCGCCAG GGCCAAGACTGGGGCAAAAGTGACCAGCGACTGCTCCAGGCAGTGGAGAACAACGATGTGGCCAGAGTGGCC

TCGTTGATCGCCCACAAGGGGCTGGTGCCTACAAAACTGGACCCCGAGGGCAAGTCTGC GTTCCACTTAGCAGCCATGAGGGGTGCGGCGGGGTGTCTG

GAAGTGATGCTGGCTCAAGGTGCCGATGTCATGAGCACGGATGGAGCAG GTTACAATGCCCTTCACCTGGCAGCCAAGTACGGGCACCCAGAGTGTCTG

AAGCAACTCTTGGAG GCTTCCTGCGTGGTGGACATCGAGGACAGCAGTGGGTGGACAGCCCTTCACCATGCAG CGGCTGGTGGTTGTCTGTCCTGCTC

AAAGCTGCTCTGTTCCTTTAAGGCACACATGAACCCCCGGGACCGG TCGGGTGCCACACCCCTCATCATAGCGGCTCAGATGTGTCACACAGATCTGTG

CCGCCTCCTCCTACAGCAGGGGGCTGCCACAAATGACCAGGACCTGCAAGGCAG GACAGCCTTGATGCTGGCATGTGAGGGGGGCAGCCCTGAGACTGT

TGAAGTACTCCTGCAGGGTGGAGCCCAGTTGAGCATCACTGATGCACTGGGCCAGGATGCCACTCACTACGGAGCCCTGACTGGAGACAAACTCATCTTG

CAGCTTCTACACGAGTCTGCACGGCGCTCTTCACCTCCCAGTG CCTCTCTAGAGGAGGACTCCGGAGAGGCCTCATCCCAGGTAGGAATCCGGAATCCG

TGAACGTCCCCAGTGCTATGCACCACTCACTGTCCCCTGACCTACAGGAAGAGACAGACCTCTATGTACAGAGTTCTGTCATGGCCCCTATCCAGGATCT

GTCCCTGCTCAGTGGCAGTGACACGAACACCAGCAGTCCTGCACACTAGGGACAGTGGATCTGGGACAGGTGACTGAGGACTGGGGTTGCTAAGGGCTGC

TTCAGGCAGAGCAAGAGCGGGCCTGGCCACTTTCCACATTCCTGCCCTGGGTCTGCTGTGTCTCAGGCTTCATGGAGAATAGAAAATGACATAGAAGCCG

ACAGAGCCAGGGAAAGTATAAAGTACCAACAGCGAACCGTACGATCTAGAGTAAGTGGGAAGACACGGGGTCCTTCACAGTATGGAGGAGGCAGGGGAGC

TGAGGCTGCTGACAGCAGCGGGTGGTCACATTGTATCCCCGAAGTGGATCCTGGCCCTGTACCCATGTGCTACACCCCCTCTGCCCATACCAGAACTCAG

TGTCAAGCCATGAGAAACAAGGAGCCCCCAAGAAGAGGAAGGCACCCCAGCCTCCAGCCAGCACACCAGTTCCT GACGATCGGGATGCTTATGAGGAGA

TTGTACGCCTGAGACAAGAGAGAGGCCGGCTCCTGCAAAAGATCAGGGGCCTGGAACAGCACAAGGAACGGAGGAGGAAGGAGGTTAGGAGGCTGCAGCC

CTGCAGTCTGGAGCAATTCCCTGGGATATCATACCACCTACCTTCCTATCCTTCCTTCACCCTTTCTTCCCCACTGTCCCTTTGCTCCTGACATGCAGCC

CCCTCACTGGCCTTTCAACAATGCAGGCTCTGTTCAGCCCTAGGGCCTTTGCCCATGGTGTCTGCAGTACAGAATTGCTGTCTCTCCAGCTGTCCCCAAG

GCTCCCTTTCTCCAACATCTCCCCTGCCACCATATTTGAAATTGTATGCTTCTTTCATTTCACCAGAGCACTCTACCACTCAAAGGCATGCTCGTGAGGG

CAGGCTTGCCCATAAGGGCAGGCTCAGGTGAAAGTGCTGAGCTCAGAGTGGATGAATACTGGATGAGGAGTGGCCCACGGTGAGGAATGAGTGAACGCAT

GCATGCATGAATGAATGAATGGCCCTGCACAGGATCTGCTACACAGCAGGCAATGTACCTAAGCGCCCTGGGTGAAAGAACAGAATGGGGTCTGACAGTG

TGAAGGATCGGTCAGAGTGGCACATAGTAGGTGCTCAGTGTACATGGAAAAAAGCCATGGCTACCAGACACTAGGTGGTAGGTGGCTGTCCAGTCCCAAC

CACTTCTACCTGCAGCCCCTGGAGGCGGAGGCCAGCTCAGTGCACAGCCTGGAGAGACAG GTGCAGGAGCTGCAACAGATGCTGGCGGAGAAGCAGGAG

GAGAAGGAGAGCCTGGGCCGGGAGGTGGAGAGCCTGCAGAGCCGTCTGTCCCTGCTGGAG AATGAGAGAGAAAACACAAGCTATGATGTAGCTACCCTG

CAGGATGAGGAGGGTGAGATGCCTGACTTCCCAG GAGCTGATGCACTGATGCCAAAGAACCAGAGTCCATCAGCAGAGGAAATAGTTGCTTCCCTACAG

GAGCAGGTGGCTCAGCTCACCAGGCAGAACCAGGAGCTGCTGGAAAAGGTCCAG - UNI30832 - ATCCTTGAGGAGTTTGAAAAGGATGAGGCGCA

GATGGCAGAAGAAAGTCAGGCCGAGGTCGTCCCCCTGGTCTTGTATGAATCCTTACGGGCAGAGCTTGAGCAGCTTCGGAGGCAATACACAGAGGCCATG

CATTCGCAGCAGCAGCAGCAGGAGGGGGAGCCACCCAGGGCTCAAGAAGGAGAAGAGACAGCATACCAGGAAATCAAGGATAAGGGAATCACTATCCAGA

ATGGACCCAGCGTCCCAGACCTCAACGGCACCACATATGCAGAAACCAAAGCAAATGGAATGGAACTCCAAGCAGGAGGCTCCAAGGGTGTCTGGAATAC

TGAAGCAGGGGTTTCAGAAGCAGCACCCATAGAACCCGAGGCTGCAGGTTCAGAGGCCACGGGGAAAGACAGACTGGCAGCCAAGGAAATGGACACTAGT

GCTACTATGGCTGAGGCCCTAAATGTGAAAGCTCTAGGTGACAATGCCGAAAGTGAGCCAGTGGCTGCCGAAGATACAGGAGGAAAAGAGAATCCAGGAA

TGAAAGCTGATGAGGTGGATGTGTTGGCACAGGCAGGGCTCACAGGTACAGTGATTAGAAACATGGAGGCCATCGGAGTGCGGGATACAGGAATTCAGGC

CACAGGATTAGAGGCTAAGGCAGTGAAGACCACTGGAGTGCAGGCCACAGTGGCGGAGGTCATAGGAGTGAAGGTCACAGGAGTGCAGACCACAGCGATA

GAAGCTATAGGAGTCAAGGACACCACCCAGGTGGCCACAGGAGCGCAGGCCGATTGCTGGCAGGCCACGGAGGCAGACTGCACCGGAGCGCAGGACACAG

CTATGGAGCCCACGGGGGCACAGGCCACTGTGACAGAGACTACGGAAGCCGAGACCAGCGGCACGGAGGACCCTTGCGCTGCGATCCTGCACCCGGGGGC

GGCGGCGGCGGCGCTGCAGGCCGAGCTGGAGACCCGGATCCGCGGTCTGGAGGAGGCGCTACGCAGAAGGGAGCGGGAGGCTGCGGCCGAGTTAGAGGCT

GCTCGGGGCCGTTTTGCAGAGGCTGAGGAGGCGGCGCGGGGGCGGAGCCGCGAGCTAGAGGCGCTTCGGGAATTGCTGGCCACGGCCACGGCTACCGGCG

AGCGCGCACGCACAGAGGCCGCCGAGTTGCGCCAAGCGCTAGCTGCCTCCGAGGCTCGGGTCGCCGAACTCAGCTCTACCGTGGACGCCGCTCGCGAGGA

GCTGGAGCGCATGCGCGGGGCCTCGGTTCCTGCGGACGAGCACGAGCACGCGCTGAGCGCCCTGCGCGACCACGTGACCCGGCTGCAGGCGCAGCTGGCG

GACCTGGCGCGCAGGCACGAGAAGACTAGCGCAGAGGTCTTCCAG - UNI20707 - - UNI32855 - ATCACAGACCTGTCCAAAGAAGTCTTTA

CACTGAAGGAGGCTCTGAAGGTGCAGCAGTCCACCCCAGCCAGCTCCAAGGAGGAGGAGGCTCTGCGCGGCCAGGTGACAGCCCTGCAGCAGCAGATACA

G - UNI20707 - GAGGAGGCCCGGGAGCATGGCGCTGTGGTGGCTTTATACCGCACCCATCTCCTGTATGCCATTCAG - UNI19665 - GGACA

GATGGATGAGGATGTACAGTGCATTTTGAGCCAGATTCTGCAGATGCAGCGGCTTCAGGCTCAGGGTCGCTGAGGACACAGCTCAACTGTTCAGTCTCCA

TCCTTCACCTCTACAAGCAGAAGCCACAGACACCATCTTCCCCAGCTCCCAGGGGATGAACAAGATTCAACACTCAATGGGAGACCAGCCTGGGGCCTTA

TCGATGGTGGCCAGCTGACCACCCCACACTCCCTATAGTCTGTTCCTCTGATTCCCAGCACTCCCCATTTGATATATTGGGAACCCTGATATGCCACCTA

CATCACAACCCCCACTCAGGAGGACAAGCTTGGTGTGTGTATGTGTGTGTGTAAAAGGGCGGGGGGTGGGGTGGGGCAGGAATACCCAGTGTGACACACT

GGGTAAGGGCAGCTATGGGGCAGGGGACTCAGGACACAGTTTGATCTTCTGGTTCCATAACACGACTATGGCAATAAATGTAAGTGCAATGTAATATTTA

AAG
Translation
MKQLCLCAAASFA LRLSPTDLSSCPPCGRCPIPKPAARGRRQ GQDWGKSDQRLLQAVENNDVARVASLIAHKGLVPTKLDPEGKSA AFHLAAMRGAA

GCLEVMLAQGADVMSTDGAG GYNALHLAAKYGHPECLKQLLE ASCVVDIEDSSGWTALHHAA AAGGCLSCSKLLCSFKAHMNPRDR SGATPLIIAA

QMCHTDLCRLLLQQGAATNDQDLQGR RTALMLACEGGSPETVEVLLQGGAQLSITDALGQDATHYGALTGDKLILQLLHESARRSSPPSA ASLEEDSG

EASSQVGIRNP     - UNI30832 -  - UNI20707 - - UNI32855 -  - UNI20707 -  - UNI19665 - 
Transcript ENSMUST00000119336
Sequence
CCTGAG TTGAGGACAGTTCCTTCAGAGGGTGCAAGTAGCCTGAACTTGGACACACAGCAGATTTGCCCAGGCTGTGTTGTGAGGACAGTGTGGCTGACC

ACCCCAGCATCCTGTCCCTCACCCGACCCACGCCTTGTCCAGAAACAAGACGAGAGCCCCTAGCAGGTGTGATGAAGACCCTCCGGGCACGATTCAAGAA

AACAGAG GGCCAAGACTGGGGCAAAAGTGACCAGCGACTGCTCCAGGCAGTGGAGAACAACGATGTGGCCAGAGTGGCCTCGTTGATCGCCCACAAGGG

GCTGGTGCCTACAAAACTGGACCCCGAGGGCAAGTCTGC GTTCCACTTAGCAGCCATGAGGGGTGCGGCGGGGTGTCTGGAAGTGATGCTGGCTCAAGG

TGCCGATGTCATGAGCACGGATGGAGCAG GTTACAATGCCCTTCACCTGGCAGCCAAGTACGGGCACCCAGAGTGTCTGAAGCAACTCTTGGAG GCTT

CCTGCGTGGTGGACATCGAGGACAGCAGTGGGTGGACAGCCCTTCACCATGCAG CGGCTGGTGGTTGTCTGTCCTGCTCAAAGCTGCTCTGTTCCTTTA

AGGCACACATGAACCCCCGGGACCGG TCGGGTGCCACACCCCTCATCATAGCGGCTCAGATGTGTCACACAGATCTGTGCCGCCTCCTCCTACAGCAGG

GGGCTGCCACAAATGACCAGGACCTGCAAGGCAG GACAGCCTTGATGCTGGCATGTGAGGGGGGCAGCCCTGAGACTGTTGAAGTACTCCTGCAGGGTG

GAGCCCAGTTGAGCATCACTGATGCACTGGGCCAGGATGCCACTCACTACGGAGCCCTGACTGGAGACAAACTCATCTTGCAGCTTCTACACGAGTCTGC

ACGGCGCTCTTCACCTCCCAGTG CCTCTCTAGAGGAGGACTCCGGAGAGGCCTCATCCCAG AACTCAGTGTCAAGCCATGAGAAACAAGGAGCCCCCA

AGAAGAGGAAGGCACCCCAGCCTCCAGCCAGCACACCAGTTCCT GACGATCGGGATGCTTATGAGGAGATTGTACGCCTGAGACAAGAGAGAGGCCGGC

TCCTGCAAAAGATCAGGGGCCTGGAACAGCACAAGGAACGGAGGAGGAAGGAG CCCCTGGAGGCGGAGGCCAGCTCAGTGCACAGCCTGGAGAGACAG 

GTGCAGGAGCTGCAACAGATGCTGGCGGAGAAGCAGGAGGAGAAGGAGAGCCTGGGCCGGGAGGTGGAGAGCCTGCAGAGCCGTCTGTCCCTGCTGGAG 

AATGAGAGAGAAAACACAAGCTATGATGTAGCTACCCTGCAGGATGAGGAGGGTGAGATGCCTGACTTCCCAG GAGCTGATGCACTGATGCCAAAGAAC

CAGAGTCCATCAGCAGAGGAAATAGTTGCTTCCCTACAGGAGCAGGTGGCTCAGCTCACCAGGCAGAACCAGGAGCTGCTGGAAAAGGTCCAG - UNI3

0832 - ATCCTTGAGGAGTTTGAAAAGGATGAGGCGCAGATGGCAGAAGAAAGTCAGGCCGAGGTCGTCCCCCTGGTCTTGTATGAATCCTTACGGGCA

GAGCTTGAGCAGCTTCGGAGGCAATACACAGAGGCCATGCATTCGCAGCAGCAGCAGCAGGAGGGGGAGCCACCCAGGGCTCAAGAAGGAGAAGAGACAG

CATACCAGGAAATCAAGGATAAGGGAATCACTATCCAGAATGGACCCAGCGTCCCAGACCTCAACGGCACCACATATGCAGAAACCAAAGCAAATGGAAT

GGAACTCCAAGCAGGAGGCTCCAAGGGTGTCTGGAATACTGAAGCAGGGGTTTCAGAAGCAGCACCCATAGAACCCGAGGCTGCAGGTTCAGAGGCCACG

GGGAAAGACAGACTGGCAGCCAAGGAAATGGACACTAGTGCTACTATGGCTGAGGCCCTAAATGTGAAAGCTCTAGGTGACAATGCCGAAAGTGAGCCAG

TGGCTGCCGAAGATACAGGAGGAAAAGAGAATCCAGGAATGAAAGCTGATGAGGTGGATGTGTTGGCACAGGCAGGGCTCACAGGTACAGTGATTAGAAA

CATGGAGGCCATCGGAGTGCGGGATACAGGAATTCAGGCCACAGGATTAGAGGCTAAGGCAGTGAAGACCACTGGAGTGCAGGCCACAGTGGCGGAGGTC

ATAGGAGTGAAGGTCACAGGAGTGCAGACCACAGCGATAGAAGCTATAGGAGTCAAGGACACCACCCAGGTGGCCACAGGAGCGCAGGCCGATTGCTGGC

AGGCCACGGAGGCAGACTGCACCGGAGCGCAGGACACAGCTATGGAGCCCACGGGGGCACAGGCCACTGTGACAGAGACTACGGAAGCCGAGACCAGCGG

CACGGAGGACCCTTGCGCTGCGATCCTGCACCCGGGGGCGGCGGCGGCGGCGCTGCAGGCCGAGCTGGAGACCCGGATCCGCGGTCTGGAGGAGGCGCTA

CGCAGAAGGGAGCGGGAGGCTGCGGCCGAGTTAGAGGCTGCTCGGGGCCGTTTTGCAGAGGCTGAGGAGGCGGCGCGGGGGCGGAGCCGCGAGCTAGAGG

CGCTTCGGGAATTGCTGGCCACGGCCACGGCTACCGGCGAGCGCGCACGCACAGAGGCCGCCGAGTTGCGCCAAGCGCTAGCTGCCTCCGAGGCTCGGGT

CGCCGAACTCAGCTCTACCGTGGACGCCGCTCGCGAGGAGCTGGAGCGCATGCGCGGGGCCTCGGTTCCTGCGGACGAGCACGAGCACGCGCTGAGCGCC

CTGCGCGACCACGTGACCCGGCTGCAGGCGCAGCTGGCGGACCTGGCGCGCAGGCACGAGAAGACTAGCGCAGAGGTCTTCCAG - UNI20707 - - 

UNI32855 - ATCACAGACCTGTCCAAAGAAGTCTTTACACTGAAGGAGGCTCTGAAGGTGCAGCAGTCCACCCCAGCCAGCTCCAAGGAGGAGGAGGC

TCTGCGCGGCCAGGTGACAGCCCTGCAGCAGCAGATACAG - UNI20707 - GAGGAGGCCCGGGAGCATGGCGCTGTGGTGGCTTTATACCGCACCC

ATCTCCTGTATGCCATTCAG - UNI19665 - GGACAGATGGATGAGGATGTACAGTGCATTTTGAGCCAGATTCTGCAGATGCAGCGGCTTCAGGCT

CAGGGTCGCTGAGGACACAGCTCAACTGTTCAGTCTCCATCCTTCACCTCTACAAGCAGAAGCCACAGACACCATCTTCCCCAGCTCCCAGGGGATGAAC

AAGATTCAACACTCAATGGGAGACCAGCCTGGGGCCTTATCGATGGTGGCCAGCTGACCACCCCACACTCCCTATAGTCTGTTCCTCTGATTCCCAGCAC

TCCCCATTTGATATATTGGGAACCCTGATATGCCACCTACATCACAACCCCCACTCAGGAGGACAAGCTTGGTGTGTGTATGTGTGTGTGTAAAAGGGCG

GGGGGTGGGGTGGGGCAGGAATACCCAGTGTGACACACTGGGTAAGGGCAGCTATGGGGCAGGGGACTCAGGACACAGTTTGATCTTCTGGTTCCATAAC

ACGACTATGGCAATAAATGTAAGTGCAATGTAATATTTAAAGAAA
Translation
 MKTLRARFKKTE GQDWGKSDQRLLQAVENNDVARVASLIAHKGLVPTKLDPEGKSA AFHLAAMRGAAGCLEVMLAQGADVMSTDGAG GYNALHLAA

KYGHPECLKQLLE ASCVVDIEDSSGWTALHHAA AAGGCLSCSKLLCSFKAHMNPRDR SGATPLIIAAQMCHTDLCRLLLQQGAATNDQDLQGR RTA

LMLACEGGSPETVEVLLQGGAQLSITDALGQDATHYGALTGDKLILQLLHESARRSSPPSA ASLEEDSGEASSQ NSVSSHEKQGAPKKRKAPQPPAST

PVP DDRDAYEEIVRLRQERGRLLQKIRGLEQHKERRRKE PLEAEASSVHSLERQ VQELQQMLAEKQEEKESLGREVESLQSRLSLLE NERENTSYD

VATLQDEEGEMPDFPG GADALMPKNQSPSAEEIVASLQEQVAQLTRQNQELLEKVQ - UNI30832 - ILEEFEKDEAQMAEESQAEVVPLVLYESL

RAELEQLRRQYTEAMHSQQQQQEGEPPRAQEGEETAYQEIKDKGITIQNGPSVPDLNGTTYAETKANGMELQAGGSKGVWNTEAGVSEAAPIEPEAAGSE

ATGKDRLAAKEMDTSATMAEALNVKALGDNAESEPVAAEDTGGKENPGMKADEVDVLAQAGLTGTVIRNMEAIGVRDTGIQATGLEAKAVKTTGVQATVA

EVIGVKVTGVQTTAIEAIGVKDTTQVATGAQADCWQATEADCTGAQDTAMEPTGAQATVTETTEAETSGTEDPCAAILHPGAAAAALQAELETRIRGLEE

ALRRREREAAAELEAARGRFAEAEEAARGRSRELEALRELLATATATGERARTEAAELRQALAASEARVAELSSTVDAAREELERMRGASVPADEHEHAL

SALRDHVTRLQAQLADLARRHEKTSAEVFQ - UNI20707 - - UNI32855 - ITDLSKEVFTLKEALKVQQSTPASSKEEEALRGQVTALQQQIQ

 - UNI20707 - EEAREHGAVVALYRTHLLYAIQ - UNI19665 - GQMDEDVQCILSQILQMQRLQAQGR
Transcript ENSMUST00000011420
Sequence
AGTTGAGGACAGTTCCTTCAGAGGGTGCAAGTAGCCTGAACTTGGACACACAGCAGATTTGCCCAGGCTGTGTTGTGAGGACAGTGTGGCTGACCACCCC

AGCATCCTGTCCCTCACCCGACCCACGCCTTGTCCAGAAACAAGACGAGAGCCCCTAGCAGGTGTGATGAAGACCCTCCGGGCACGATTCAAGAAAACAG

AG GGCCAAGACTGGGGCAAAAGTGACCAGCGACTGCTCCAGGCAGTGGAGAACAACGATGTGGCCAGAGTGGCCTCGTTGATCGCCCACAAGGGGCTGG

TGCCTACAAAACTGGACCCCGAGGGCAAGTCTGC GTTCCACTTAGCAGCCATGAGGGGTGCGGCGGGGTGTCTGGAAGTGATGCTGGCTCAAGGTGCCG

ATGTCATGAGCACGGATGGAGCAG GTTACAATGCCCTTCACCTGGCAGCCAAGTACGGGCACCCAGAGTGTCTGAAGCAACTCTTGGAG GCTTCCTGC

GTGGTGGACATCGAGGACAGCAGTGGGTGGACAGCCCTTCACCATGCAG CGGCTGGTGGTTGTCTGTCCTGCTCAAAGCTGCTCTGTTCCTTTAAGGCA

CACATGAACCCCCGGGACCGG TCGGGTGCCACACCCCTCATCATAGCGGCTCAGATGTGTCACACAGATCTGTGCCGCCTCCTCCTACAGCAGGGGGCT

GCCACAAATGACCAGGACCTGCAAGGCAG GACAGCCTTGATGCTGGCATGTGAGGGGGGCAGCCCTGAGACTGTTGAAGTACTCCTGCAGGGTGGAGCC

CAGTTGAGCATCACTGATGCACTGGGCCAGGATGCCACTCACTACGGAGCCCTGACTGGAGACAAACTCATCTTGCAGCTTCTACACGAGTCTGCACGGC

GCTCTTCACCTCCCAGTG CCTCTCTAGAGGAGGACTCCGGAGAGGCCTCATCCCAG AACTCAGTGTCAAGCCATGAGAAACAAGGAGCCCCCAAGAAG

AGGAAGGCACCCCAGCCTCCAGCCAGCACACCAGTTCCT GACGATCGGGATGCTTATGAGGAGATTGTACGCCTGAGACAAGAGAGAGGCCGGCTCCTG

CAAAAGATCAGGGGCCTGGAACAGCACAAGGAACGGAGGAGGAAGGAG CCCCTGGAGGCGGAGGCCAGCTCAGTGCACAGCCTGGAGAGACAG GTGCA

GGAGCTGCAACAGATGCTGGCGGAGAAGCAGGAGGAGAAGGAGAGCCTGGGCCGGGAGGTGGAGAGCCTGCAGAGCCGTCTGTCCCTGCTGGAG AATGA

GAGAGAAAACACAAGCTATGATGTAGCTACCCTGCAGGATGAGGAGGGTGAGATGCCTGACTTCCCAG GAGCTGATGCACTGATGCCAAAGAACCAGAG

TCCATCAGCAGAGGAAATAGTTGCTTCCCTACAGGAGCAGGTGGCTCAGCTCACCAGGCAGAACCAGGAGCTGCTGGAAAAGGTCCAG - UNI30832 

- ATCCTTGAGGAGTTTGAAAAGGATGAGGCGCAGATGGCAGAAGAAAGTCAGGCCGAGGTCGTCCCCCTGGTCTTGTATGAATCCTTACGGGCAGAGCT

TGAGCAGCTTCGGAGGCAATACACAGAGGCCATGCATTCGCAGCAGCAGCAGCAGGAGGGGGAGCCACCCAGGGCTCAAGAAGGAGAAGAGACAGCATAC

CAGGAAATCAAGGATAAGGGAATCACTATCCAGAATGGACCCAGCGTCCCAGACCTCAACGGCACCACATATGCAGAAACCAAAGCAAATGGAATGGAAC

TCCAAGCAGGAGGCTCCAAGGGTGTCTGGAATACTGAAGCAGGGGTTTCAGAAGCAGCACCCATAGAACCCGAGGCTGCAGGTTCAGAGGCCACGGGGAA

AGACAGACTGGCAGCCAAGGAAATGGACACTAGTGCTACTATGGCTGAGGCCCTAAATGTGAAAGCTCTAGGTGACAATGCCGAAAGTGAGCCAGTGGCT

GCCGAAGATACAGGAGGAAAAGAGAATCCAGGAATGAAAGCTGATGAGGTGGATGTGTTGGCACAGGCAGGGCTCACAGGTACAGTGATTAGAAACATGG

AGGCCATCGGAGTGCGGGATACAGGAATTCAGGCCACAGGATTAGAGGCTAAGGCAGTGAAGACCACTGGAGTGCAGGCCACAGTGGCGGAGGTCATAGG

AGTGAAGGTCACAGGAGTGCAGACCACAGCGATAGAAGCTATAGGAGTCAAGGACACCACCCAGGTGGCCACAGGAGCGCAGGCCGATTGCTGGCAGGCC

ACGGAGGCAGACTGCACCGGAGCGCAGGACACAGCTATGGAGCCCACGGGGGCACAGGCCACTGTGACAGAGACTACGGAAGCCGAGACCAGCGGCACGG

AGGACCCTTGCGCTGCGATCCTGCACCCGGGGGCGGCGGCGGCGGCGCTGCAGGCCGAGCTGGAGACCCGGATCCGCGGTCTGGAGGAGGCGCTACGCAG

AAGGGAGCGGGAGGCTGCGGCCGAGTTAGAGGCTGCTCGGGGCCGTTTTGCAGAGGCTGAGGAGGCGGCGCGGGGGCGGAGCCGCGAGCTAGAGGCGCTT

CGGGAATTGCTGGCCACGGCCACGGCTACCGGCGAGCGCGCACGCACAGAGGCCGCCGAGTTGCGCCAAGCGCTAGCTGCCTCCGAGGCTCGGGTCGCCG

AACTCAGCTCTACCGTGGACGCCGCTCGCGAGGAGCTGGAGCGCATGCGCGGGGCCTCGGTTCCTGCGGACGAGCACGAGCACGCGCTGAGCGCCCTGCG

CGACCACGTGACCCGGCTGCAGGCGCAGCTGGCGGACCTGGCGCGCAGGCACGAGAAGACTAGCGCAGAGGTCTTCCAG - UNI20707 - - UNI32

855 - ATCACAGACCTGTCCAAAGAAGTCTTTACACTGAAGGAGGCTCTGAAGGTGCAGCAGTCCACCCCAGCCAGCTCCAAGGAGGAGGAGGCTCTGC

GCGGCCAGGTGACAGCCCTGCAGCAGCAGATACAG - UNI20707 - GAGGAGGCCCGGGAGCATGGCGCTGTGGTGGCTTTATACCGCACCCATCTC

CTGTATGCCATTCAG - UNI19665 - GGACAGATGGATGAGGATGTACAGTGCATTTTGAGCCAGATTCTGCAGATGCAGCGGCTTCAGGCTCAGGG

TCGCTGAGGACACAGCTCAACTGTTCAGTCTCCATCCTTCACCTCTACAAGCAGAAGCCACAGACACCATCTTCCCCAGCTCCCAGGGGATGAACAAGAT

TCAACACTCAATGGGAGACCAGCCTGGGGCCTTATCGATGGTGGCCAGCTGACCACCCCACACTCCCTATAGTCTGTTCCTCTGATTCCCAGCACTCCCC

ATTTGATATATTGGGAACCCTGATATGCCACCTACATCACAACCCCCACTCAGGAGGACAAGCTTGGTGTGTGTATGTGTGTGTGTAAAAGGGCGGGGGG

TGGGGTGGGGCAGGAATACCCAGTGTGACACACTGGGTAAGGGCAGCTATGGGGCAGGGGACTCAGGACACAGTTTGATCTTCTGGTTCCATAACACGAC

TATGGCAATAAATGTAAGTGCAATGTAATATTT
Translation
MKTLRARFKKTE GQDWGKSDQRLLQAVENNDVARVASLIAHKGLVPTKLDPEGKSA AFHLAAMRGAAGCLEVMLAQGADVMSTDGAG GYNALHLAAK

YGHPECLKQLLE ASCVVDIEDSSGWTALHHAA AAGGCLSCSKLLCSFKAHMNPRDR SGATPLIIAAQMCHTDLCRLLLQQGAATNDQDLQGR RTAL

MLACEGGSPETVEVLLQGGAQLSITDALGQDATHYGALTGDKLILQLLHESARRSSPPSA ASLEEDSGEASSQ NSVSSHEKQGAPKKRKAPQPPASTP

VP DDRDAYEEIVRLRQERGRLLQKIRGLEQHKERRRKE PLEAEASSVHSLERQ VQELQQMLAEKQEEKESLGREVESLQSRLSLLE NERENTSYDV

ATLQDEEGEMPDFPG GADALMPKNQSPSAEEIVASLQEQVAQLTRQNQELLEKVQ - UNI30832 - ILEEFEKDEAQMAEESQAEVVPLVLYESLR

AELEQLRRQYTEAMHSQQQQQEGEPPRAQEGEETAYQEIKDKGITIQNGPSVPDLNGTTYAETKANGMELQAGGSKGVWNTEAGVSEAAPIEPEAAGSEA

TGKDRLAAKEMDTSATMAEALNVKALGDNAESEPVAAEDTGGKENPGMKADEVDVLAQAGLTGTVIRNMEAIGVRDTGIQATGLEAKAVKTTGVQATVAE

VIGVKVTGVQTTAIEAIGVKDTTQVATGAQADCWQATEADCTGAQDTAMEPTGAQATVTETTEAETSGTEDPCAAILHPGAAAAALQAELETRIRGLEEA

LRRREREAAAELEAARGRFAEAEEAARGRSRELEALRELLATATATGERARTEAAELRQALAASEARVAELSSTVDAAREELERMRGASVPADEHEHALS

ALRDHVTRLQAQLADLARRHEKTSAEVFQ - UNI20707 - - UNI32855 - ITDLSKEVFTLKEALKVQQSTPASSKEEEALRGQVTALQQQIQ 

- UNI20707 - EEAREHGAVVALYRTHLLYAIQ - UNI19665 - GQMDEDVQCILSQILQMQRLQAQGR

For any suggestions or comments, please send an email to unitrap@crg.es