Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054717 (Hmgb2)
Chromosomal location
Chr 8: 59990704 - 59993291 (+)
Description
high mobility group box 2 Gene [Source:MGI Symbol;Acc:MGI:96157]
RefSeq_dna
NM_008252 
RefSeq_peptide
NP_032278.1 
UniGene
Mm.428728 Mm.438945 Mm.464965 Mm.470487 
MGI
MGI:96157 
Uniprot/SWISSPROT
P30681 
Uniprot/SPTREMBL
Q3U566 Q3UAZ7 Q9CT19 
Human Ortholog
ENSG00000164104 (HMGB2)
Omim not available
UniTrap UNI20845
Vector Insertion
Chr 8: 59992005 - 59992086
Public Clones not available
Private Clones OST350154 (lexicon)
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067925
Sequence
AAGAGGCTGGGGATTGCGTTAGCGAGAAACCAGTTCTCGCCGGAGCTTGGGGAAGGAAGTCTCTCTGCGGAGGTCTGAGGGAAGCAGCGCTCGCAGCAG 

GTAGACAGACGCCGCGCCGTCGTCATGGGCAAGGGTGACCCCAACAAGCCGCGGGGCAAAATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCCGCGAGG

AGCACAAGAAGAAGCATCCCGACTCGTCGGTGAACTTCGCCGAGTTCTCCAAGAAATGCTCCGAGAGATGGAAG ACCATGTCTGCAAAGGAAAAGTCCA

AGTTTGAAGATTTGGCCAAGAGCGACAAAGCTCGTTATGACAGGGAGATGAAGAACTATGTTCCTCCCAAAGGGGATAAGAAAGGAAAGAAAAAAGACCC

CAATGCTCCGAAGAGACCACC - UNI20845 - GTCTGCCTTCTTCCTGTTTTGCTCTGAAAATCGCCCAAAGATCAAAATTGAACACCCAGGCCTGT

CTATTGGAGATACTGCGAAGAAACTGGGTGAGATGTGGTCTGAGCAATCTGCCAAAGATAAACAACCGTATGAGCAGAAAGCAGCTAAACTAAAGGAGAA

GTATGAAAAG GATATTGCTGCATACCGTGCCAAGGGCAAAAGTGAAGCAGGAAAGAAGGGTCCTGGTAGGCCAACAGGCTCAAAGAAGAAGAACGAACC

AGAAGATGAGGAGGAGGAAGAAGAGGAGGAAGAGGAGGAAGATGACGAGGAAGAAGAGGAGGATGAAGAATAAGTGGCTGTCCTAAAGTGTGGAGTATAT

TTGCTCAGGCAATTATTTTGCTAAGAATGTGAAATTCAAGTGCAGCTCAACATTAGCTTCAGTATAAAAACTGTACAGATTTTTGTATAGCTGATGAGAT

TCTTTGTAGAGAAAATACTTTTTAAGAAGAGTTTGTAGCTTTTTCAGGGGCTACAACTACAGTTAGATTTAAAGCTTTTGATGTTGAATGTTTCTAAATA

TTTAATGGTTTCTTTAATTTCTTATGCTAGCAAAAAAAAAACTTCATAGGAATTTGTATTACCAGTAAAAATTTTTTTTAGGATGTTGCATTTTTTTGTT

TTTTTTTAAATTTGTAATAAAATAATGTATATTAATTTGC
Translation
 MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWK TMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRP

P - UNI20845 - PSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEK DIAAYRAKGKSEAGKKGPGRPTGSK

KKNEPEDEEEEEEEEEEEDDEEEEEDEE

For any suggestions or comments, please send an email to unitrap@crg.es