Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054723 (AI662250)
Chromosomal location
Chr 17: 56853361 - 56856400 (-)
Description
Vimentin-type intermediate filament-associated coiled-coil protein  [Source:UniProtKB/Swiss-Prot;Acc:Q8BP01]
RefSeq_dna
NM_178926 
RefSeq_peptide
NP_849257.1 
UniGene
Mm.37290 
MGI
MGI:2146912 
Uniprot/SWISSPROT
Q8BP01 
Human Ortholog
ENSG00000187650 (AC104532.2)
Omim not available
UniTrap UNI20711
Vector Insertion
Chr 17: 56855241 - 56856056
Public Clones (sanger)
Private Clones OST353995 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067931
Sequence
CTCTTGAGAAGGTTTAAATTAATGCAGCGGCAGCCTGGCAGCTGCATGTGAGGGAGGGGGTGGGGGGTGGGGGTCGGGCTCAGGGGCGGGGCTTCTTGCG

TTGTGGGCGTGACCCGACAGGGCGGGGTGGGGCCTGCACGGCAGCCGGGGGCCATGTCTGCGCCGCCACCTCTGCAGATCCGGGAGGCGAACGCGCACCT

GGCCGCCGTGCACCGACGCGCAGCGGAGCTGGAGAGGCGGCTGCTGGCGGCTGAGCGCACGATTGGTGCGCAGGCCGAGCGCCTGGCCTGCCACGACCAG

CACCTGCGCGCCGCCCTGGATGAGCTGGGTCGCGCCAAGGACCG - UNI20711 - GGAGATATCTGCCCTCCAAGAGCAGCTGCTGAGCTCTGAGGC

CACAGTTCGCAGCCTGCAGGCCGCAGTGGACCAGAGGGACCAGATGATCCAGCAGCTACAGCCTCGGGCTGACCTGCTGCAGGACATCACTCGCCACCGA

CCACCCCTGGCCGCACTGTTGGCCACCCTGGAGGAGGCAGAGGAACTGGGCCCCTTGCCGGCCAGCCACAGCCATAGGGCCCAGCTACTTCCTGATGGGC

CTGGCCCACCCCTGGGCAACAACATGGGAAAGGAGGAGGGCCAGGACGACCAGGACGACCAGCAGCCTGCTGTGTTTGGGACCACGGTGTGAGCTGTCCT

GACAGATCTCAGAATCTGTGGTCACGGCCCCATGGGGATTCCACTCTTAGAGTCCTGGACATCACCTAGAGGGGTCTTGAGACATTACCCGGATCCCATC

TAAACATCACAACAAGTGAAAACTCAAGATCTCATTTAAACCCCCCCCCCCCCCCCAGTGCTGGAGTATCTGCTACATTCCACTGGTTTTAAATAGTTTC

AAAAACAAATGAAGGTAAGGGTGGTAACTCTGGGAGGAGCATTCTCCACCAGGCATACACAAAGCCCAAGCCAGACAGGCACCCCAGCATCAGTGAGATG

GTGGGGACTGACCCTGAAACCTCGGTGTTTCCTGTTTGGGACAGGGTCCCAGGTAGCCAGGCTTGCTGTCTCAGGAGTGTGGCATGGATCCCTGCTAGGC

TGACAGGCTCCCACTACAGGCCCTGCCTGTGGGGAGTTTGTCTTTTTGCTTGAGATGGGGTCTCTCTCTATAACCCAGGCTTCCCTTGAATCCTCCTTCC

AAGTACTTGGAATCTAGATGTGAGCCACCGTGCCCTGCTGATGGGAGCACTCCCTACCTTTCTTTCTACTCACTCTTGTGCCTCCTGAACCATCCTTAAT

GCCAAGACAAATCATTAATCTTGGATCTCTCTCCCATAGCTCTACCCTTCTAGGAAGAACAAGTGGGTTGAGACACCACAACCCAGAGTGCCTCAATGTC

TTTCCCTGATTCCACACTCAGTTCCTTGACACTCAGGTCTCTCTCAAATGCCCCCTTCTGGAGGGGCCTTCCAACCAGCATCTCTGAAGTCATTCCTGCC

AGCTGGTCACTGCCCTGTACTGTGATTGTTTGGTCTAGTTTTTCTGAAGCTTAGTCTTATGTAGCTCAGGCTGGCCTCTAAAATTTTTATGTAGCTCAAG

CTGGATTTAAACTTTTGATCCTCCTGCTTCAGCATCTCCAGTGCTAGTATGACAGGCTTTGTGCAAACACCCACAGCCCCATCCTGGGACCACCTTTTCA

GTGGGAAGGCAGTGGCTATGAAGCAGGGAATTTTGTCTTCTGTCTCCATCAGTGCCTAGCACAGCCCGGGAGGCCCTGCCTTAGCCAGGAGCCTTCTGGA

TACCTGATAAGCCCTTTCCTGGTTTCCAGGGACAATGATGTTTTTGTAGCAAGACGCCTTTTTGATACCCTAAGAGAATCTATTTTTTAAATCCTGGTTT

CTGTGCTGCCTAGAGCCTATGATGGTGAGGGTGCATTGCCCTTGTTAGAGCAGTGAGAGGAAGGGGCCCCACAAGCCCTTGCACCCAGAGGTGGTGTCTG

TTGAATTCCATGACCTGTGCGCTCAGGGAAATTGTCCTTGAGCAGCCACCAAGATAGAAGGTAGGGGGTGTTCGAAACAGAAGGGCCTCCAGCCATCCAG

TCTACCCAGAGTCTGACATGGACCCTCAGTGTGGGAGACAGAGGCCCATTTTTTCTTGGGGATGGAGGAAAGAAGGGAGCTATCTGTATAGAAGGCAGAC

TAGGGCCTGTCTGCACCAGAATAAATTGGCTATTTCTC
Translation
MSAPPPLQIREANAHLAAVHRRAAELERRLLAAERTIGAQAERLACHDQHLRAALDELGRAKDR - UNI20711 - REISALQEQLLSSEATVRSLQA

AVDQRDQMIQQLQPRADLLQDITRHRPPLAALLATLEEAEELGPLPASHSHRAQLLPDGPGPPLGNNMGKEEGQDDQDDQQPAVFGTTV

For any suggestions or comments, please send an email to unitrap@crg.es