Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054733 (Msra)
Chromosomal location
Chr 14: 64741466 - 65074740 (-)
Description
methionine sulfoxide reductase A Gene [Source:MGI Symbol;Acc:MGI:106916]
RefSeq_dna
NM_026322 
RefSeq_peptide
NP_080598.2 
MGI
MGI:106916 
Uniprot/SWISSPROT
Q9D6Y7 
Uniprot/SPTREMBL
Q91WK9 Q5EBQ7 
Human Ortholog
ENSG00000175806 (MSRA)
Omim not available
UniTrap UNI32352
Vector Insertion
Chr 14: 64932523 - 65059864
Public Clones PST18272-NR (escells) IST12042E9 (tigm) IST14960G2 (tigm) IST14820A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17687
Vector Insertion
Chr 14: 64829372 - 64852665
Public Clones IST12888H1 (tigm)
Private Clones OST438182 (lexicon) OST286391 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26482
Vector Insertion
Chr 14: 64742191 - 64829264
Public Clones IST13952A11 (tigm) IST12452D2 (tigm) IST12878A10 (tigm)
Private Clones OST115369 (lexicon) OST31587 (lexicon) OST31281 (lexicon) OST31254 (lexicon)
OST28981 (lexicon) OST28963 (lexicon) OST28631 (lexicon) OST26972 (lexicon)
OST26945 (lexicon) OST23762 (lexicon) OST23391 (lexicon) OST19048 (lexicon)
OST18074 (lexicon) OST17515 (lexicon) OST10660 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089333
Sequence
AACGCCCTGGTCATACAGGAGG GCTGTGGAAGTCTATCTGCTGTTCTGAAATGGCCTCAGGCTTCAAGCCTTTCAGAGCCTCCTTGGCCTTCCCAAGGC

TGGAATGACTTCTCTCTCTGGGAGACAACACTCCATTCTGTAGGGGTGACGTCTGTAG GAAGATCACCGTTTGAAGAAGTGCTGGTGGAAAGACAATTG

TGGTCTAGAAAATTCCTGCAGATAATTTATAGGTGACATAAGTAAGATTAAACTGAACACT CTTCGAGGAAACTAACACGATGAAGATTAGCAAGGTCG

GATGGCCTGTGGGGCTGCAAGAAAACCAGACGCTGCTTGAA GGGAAGTGTCTGCTGACAGCGCATGCGCATGCCTGGAGCTCAGCTTCGAGATCTTCCT

ATCTGTGGAGTAAGAAG - UNI32352 - TGAGTACATCGCACCCGGAACCCTGGCTGCGGAGGTGGAGAAACGGCAGCAACTCTGACCTCCCGCGGT

GGCGCCCAGCCAGCATCAATTTTGGCCCGCGCGGCTTCACGTACTCTGGGAACTTTGTCCCTCAGAGACAGCCAGGCCTGGAGGTCTGCCCCGCGAGACG

GACACGCCGCCCATGCTCTCCGCCTCTAGAAGGGCTCTCCAGCTCCTCTCTAGCGCCAACCCGGTACGGAGGATGGGCGACTCAGCTTCGAAAGTCATCT

CCGCAGAGGAAGCCTTGCCGGGACGCACCGAGCCGATCCCTGTAACAG - UNI32352 - CCAAACACCATGTCAGTGGCAACAGAACGGTTGAACCT

TTCCCAGAGGGAACACAGATGGCTGTATTTG - UNI32352 - AAAAAACTGGCCACGCCGAAGTCGTCCGGGTTGTGTACCGGCCAGAGCACATCAG

CTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAATCACGACCCGACCCAAG - UNI17687 - GCATGCGCCAAGGCAATGACTTTGGTACACAGTACC

GGTCAGCAGTCTATCCCACATCCGCCGTGCAGATGGAAGCAGCCCTGAGATCCAAGGAAGAATACCAAAAG - UNI26482 - GTTCTTTCAAAGCAT

AACTTTGGCCCCATCACCACCGACATCCGAGAGGGACAAGTGTTCTACTATGCCGAAGACTACCACCAGCAATACCTGAGCAAGAACCCAGACGGCTACT

GTGGCCTCGGGGGTACTGGAGTTTCCTGCCCGATGGCCATTAAAAAATAATTTCTCTCCACGAAGCTGTCCCTGAAGGTTCCATCAACACCATGATTGCT

GGATGGAGTGGCACTGCTGTGATTCACATCTGTCACTTTATGCAAAGCACACACACCACACGGACCTTTACATGAATCTGGTTGTTATTGGGGTTTGATT

TCCAGAGAGTAGCATGACAAGGTGATACACTGTAATCTGCCTTCTGATCAGTCCGGGTGGGGACAAATCATGACATTTTAGTGGATTGTTTGGATCTGCT

CAGACTGGAAGGATGCTGAGGGTTCTGAAGCAGGGGGATGGCCAGGAGAGCACAGGGTACTGGGACCCCTTGGTCTGTGCTGACATACCTCACCCACTTC

CCTGCCCTCGGGTGCCCAATTCATTAGTGTCTACAGATCCCATGAATCATTTGCCAAATCGCTTTGCTCTGCTGGCTCTAGATGTGTACTAGGGGTTTCT

CTCCCCCTCCATCCTCTCTGCAGAGAAAAGACAGGAGTGACCTTAATGAATTCTAACATTCTGCTTACAGCTATGATAAAGCTTGTTCTAATAAAAATCT

GCAGTTTGGT
Translation
     - UNI32352 - MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTA - UNI32352 - AKHHVSGNRTVEPFPEGTQMAV

FE - UNI32352 - EKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQG - UNI17687 - GMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEY

QK - UNI26482 - VLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLGGTGVSCPMAIKK
Transcript ENSMUST00000067927
Sequence
AACGCCCTGGTCATACAGGAGG GCTGTGGAAGTCTATCTGCTGTTCTGAAATGGCCTCAGGCTTCAAGCCTTTCAGAGCCTCCTTGGCCTTCCCAAGGC

TGGAATGACTTCTCTCTCTGGGAGACAACACTCCATTCTGTAGGGGTGACGTCTGTAG GAAGATCACCGTTTGAAGAAGTGCTGGTGGAAAGACAATTG

TGGTCTAGAAAATTCCTGCAGATAATTTATAGGTGACATAAGTAAGATTAAACTGAACACT CTTCGAGGAAACTAACACGATGAAGATTAGCAAGGTCG

GATGGCCTGTGGGGCTGCAAGAAAACCAGACGCTGCTTGAA GGGAAGTGTCTGCTGACAGCGCATGCGCATGCCTGGAGCTCAGCTTCGAGATCTTCCT

ATCTGTGGAGTAAGAAG - UNI32352 - TGAGTACATCGCACCCGGAACCCTGGCTGCGGAGGTGGAGAAACGGCAGCAACTCTGACCTCCCGCGGT

GGCGCCCAGCCAGCATCAATTTTGGCCCGCGCGGCTTCACGTACTCTGGGAACTTTGTCCCTCAGAGACAGCCAGGCCTGGAGGTCTGCCCCGCGAGACG

GACACGCCGCCCATGCTCTCCGCCTCTAGAAGGGCTCTCCAGCTCCTCTCTAGCGCCAACCCGGTACGGAGGATGGGCGACTCAGCTTCGAAAGTCATCT

CCGCAGAGGAAGCCTTGCCGGGACGCACCGAGCCGATCCCTGTAACAG - UNI32352 - CCAAACACCATGTCAGTGGCAACAGAACGGTTGAACCT

TTCCCAGAGGGAACACAGATGGCTGTATTTG - UNI32352 - GAATGGGCTGCTTCTGGGGAGCTGAGCGCAAGTTCTGGGTCTTGAAAGGAGTGTA

CTCAACCCAAGTGGGCTTTGCAGGAGGCCACACACGCAATCCCACCTACAAAGAGGTCTGCTCAG AAAAAACTGGCCACGCCGAAGTCGTCCGGGTTGT

GTACCGGCCAGAGCACATCAGCTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAATCACGACCCGACCCAAG - UNI17687 - GCATGCGCCAAGGCA

ATGACTTTGGTACACAGTACCGGTCAGCAGTCTATCCCACATCCGCCGTGCAGATGGAAGCAGCCCTGAGATCCAAGGAAGAATACCAAAAG - UNI26

482 - GTTCTTTCAAAGCATAACTTTGGCCCCATCACCACCGACATCCGAGAGGGACAAGTGTTCTACTATGCCGAAGACTACCACCAGCAATACCTGA

GCAAGAACCCAGACGGCTACTGTGGCCTCGGGGGTACTGGAGTTTCCTGCCCGATGGCCATTAAAAAATAATTTCTCTCCACGAAGCTGTCCCTGAAGGT

TCCATCAACACCATGATTGCTGGATGGAGTGGCACTGCTGTGATTCACATCTGTCACTTTATGCAAAGCACACACACCACACGGACCTTTACATGAATCT

GGTTGTTATTGGGGTTTGATTTCCAGAGAGTAGCATGACAAGGTGATACACTGTAATCTGCCTTCTGATCAGTCCGGGTGGGGACAAATCATGACATTTT

AGTGGATTGTTTGGATCTGCTCAGACTGGAAGGATGCTGAGGGTTCTGAAGCAGGGGGATGGCCAGGAGAGCACAGGGTACTGGGACCCCTTGGTCTGTG

CTGACATACCTCACCCACTTCCCTGCCCTCGGGTGCCCAATTCATTAGTGTCTACAGATCCCATGAATCATTTGCCAAATCGCTTTGCTCTGCTGGCTCT

AGATGTGTACTAGGGGTTTCTCTCCCCCTCCATCCTCTCTGCAGAGAAAAGACAGGAGTGACCTTAATGAATTCTAACATTCTGCTTACAGCTATGATAA

AGCTTGTTCTAATAAAAATCTGCAGTTTGGT
Translation
     - UNI32352 - MLSASRRALQLLSSANPVRRMGDSASKVISAEEALPGRTEPIPVTA - UNI32352 - AKHHVSGNRTVEPFPEGTQMAV

FG - UNI32352 - GMGCFWGAERKFWVLKGVYSTQVGFAGGHTRNPTYKEVCSE EKTGHAEVVRVVYRPEHISFEELLKVFWENHDPTQG - UNI

17687 - GMRQGNDFGTQYRSAVYPTSAVQMEAALRSKEEYQK - UNI26482 - VLSKHNFGPITTDIREGQVFYYAEDYHQQYLSKNPDGYCGLG

GTGVSCPMAIKK

For any suggestions or comments, please send an email to unitrap@crg.es