Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054753 (AU018091)
Chromosomal location
Chr 7: 3154665 - 3169204 (-)
Description
cationic amino acid transporter 5  [Source:RefSeq peptide;Acc:NP_001004153]
RefSeq_dna
NM_001004153 
RefSeq_peptide
NP_001004153.1 
UniGene
Mm.268551 
MGI
MGI:2142124 
Uniprot/SPTREMBL
Q0PDJ1 Q5RJY3 Q66JW0 Q80UM0 
Human Ortholog
not available
Omim not available
UniTrap UNI11841
Vector Insertion
Chr 7: 3164299 - 3169015
Public Clones (sanger) 5SD088B03 (ggtc) P112A09 (ggtc) 5SD029G10 (ggtc) 5SE067H07 (ggtc)
3SD029G10 (ggtc) 3SE067H07 (ggtc) IST12305F10 (tigm) IST12838A5 (tigm)
IST12995A12 (tigm) IST12594D9 (tigm) IST10665B4 (tigm) IST12663A12 (tigm)
IST13073E10 (tigm) IST14614E5 (tigm) IST13058D3 (tigm) IST13119H1 (tigm)
IST12078B8 (tigm) IST11674C12 (tigm) IST14853B9 (tigm) IST14268G9 (tigm)
IST13070G8 (tigm) IST14461G6 (tigm) IST13640F9 (tigm) IST12833E8 (tigm)
IST14967H6 (tigm)
Private Clones OST302943 (lexicon) OST243256 (lexicon) OST225815 (lexicon) OST207202 (lexicon)
OST205598 (lexicon) OST155461 (lexicon) OST149252 (lexicon) OST67794 (lexicon)
OST51506 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30984
Vector Insertion
Chr 7: 3162202 - 3164299
Public Clones IST11629G6 (tigm) IST11186H2 (tigm) IST10454H12 (tigm) IST11657B3 (tigm)
IST14666C8 (tigm) IST14017E6 (tigm) IST12317B12 (tigm) IST10277C4 (tigm)
IST14142H2 (tigm) IST14846D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34539
Vector Insertion
Chr 7: 3159429 - 3161410
Public Clones IST14671H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067969
Sequence
CAGATGAGCTGTCAGCTGTCCCTCCCTGTTGGTCCCCACCCTACCCGCCAGGCACATTTCCGGTGGCTACTTGAATGCTGTGGGTCCTACCTCCTCCTAC

CTTAAAGAATTTTCAGCTTCTGTGCAGCACAGATCTGGAGCTCTGCCCCAGGAACACATCCAGCACTCCAGGATTTCATCCAGTGTCTG - UNI11841

 - - UNI30984 - CAGAGTTTGGATCCCTCCACCAGGCACTAAAGATGTTATGGCAGAACCTCCATCAGTTTGGCCAGAAGTTGGTTCGCCGGCGGC

CCCTGGCGGCAAACGAACAGTCTGAGTCTTCCTTGTCTCGATGTCTGACCACTTTGGACCTGGTGTCCTTGGGTGTGGGCAGTACCCTGGGTGCAGGCGT

GTATGTCCTGGCCGGGGAGGTGGCCAGAGAGAAAGCTGGACCGTCCATCATCATCTGCTTCTTAATTGCTGCCCTGTCTTCAGTGATGTCAGGACTCTGT

TATGCGGAGTTTGGGGCCAGGGTACCATGCTCGGGTTCCGCATATCTCTACAGCTATGTCACAGTGGGCCAGCTGTTGGCTTTCATCACTGGCTGGAACT

TAATACTCAACTATGTCATTG - UNI30984 - GTGCAGCCAGTGTGGCTCGGGCCTGGAGTGCAGCTTTTGATGGCCTCATAGGGAACCATATCTCC

CAAGCCATGCAGACGACTTTCCCTATCCAAGTGCCCAGCTTTCTGGCCAAGTATCCAGACTTTTTTGCGCTTGGTCTGGTGATAGTTCTCACTG - UNI

30984 - - UNI34539 - GAATCCTCGCCCTGGGAGCACGAGAGTCTGCCCTGGTCACCAGGGTTTTCACAGGAGTGAATCTTTTGGTGCTGTGTTT

CGTCTCCCTCTCTGGCCTCATTAATGGCAAGCTACACAACTGGCAGCTTACAGAGGATGACTACAAACTGGCTCTGTTAGAATCCAACAACACTGACAG 

- UNI34539 - CTTGGGACCAATGGGCTCTGGAGGGTTCATGCCTTTTGGCTTGAAGGGGATTCTCCGTGGTACAGCAACATGTTTCTTTGCCTTCAT

TGGGTTCGACTGTATTGCGAGTACAG - UNI34539 - GGGAAGAGGCCCGCTGTCCCCAGCGTTCCATTCCATTGGGCATCGTGACCTCACTCTTCA

TTTGCTTTCTGATGTATTTTGGTGTTTCGGGGGCACTCACTCTCATGATACCCTACTACCAGATTAACATCAACAGCCCCTTGCCCCAGGCATTTATCCA

CGTTGGATGGGGGCCTGCTCGCTATGCAGTAGCTGTGGGAACCTTATGTGCCCTTTCATCCAG CCTCATAGGTTCCATTTTCCCTGTGCCTCGGGTGGT

GTATTCCATGGCAGAGGATGGGCTCCTGTTCCGGAAACTTGCCTATGTTCATCCTCGAACACACACTCCGGTCCTAGCCACTGTCCTTTGTGGAATCATC

GCAG CATTTATGGCTTTCCTCGTTGAGCTCAGTGATCTGGTGGACCTCTCGTCCATAGGGACCCTGCTGGCCTACACCTTAGTGACCTTCTCTGTTCTG

ATCCTCAG GTACCAGCCGGACCAGGTCTTAAGCTCTTGTAAGAGGGAGAAGTCTGAGAGTGCAGCTGTGGAGCTGGAGCCTGGACTTGAACCTTCTTCA

TGCATGGAGCCTATTTCTCCAGAAGGGATGCCAGGGATTGCAAGGACACTCTGTATCCCCACGAACACCACCCCAACTCTGAGATCTGGCCGGATTGTCT

ATGGATGTGCTTCCCTGCTCG TCTTTCTTCTGATGCTCCTGTGCCTGATCCTGACCCAGTGGTCCACACAGCTATTCTCTGGGGACCCAGTTTTGATTG

CCATGGCTGCTTCACTATTGCTTCTTACTGTCGGAGTGATCACTGTCATCTGGAGACAGCCTCAGAGCACCACTCCTCTCCACTTCAAG GTTCCAGCCC

TGCCTGTGCTTCCTGCACTGAGTATCTTTGTGAATATCTACCTGATGATGCAAATGACTTCTGGGACCTGGTTTCGCTTTGGAATCTGGATGGTGATCG 

GATTTGCTATCTACTTTGGATATGGGATACAGCACAGCTTGGAAGAGAAGAATGACCAACAGCCAACAGCCTCAAGCTCCCAGACTCTCCAGGAACTCCA

GGAACATACTCCCAGTGTTGACTTACCTTAACTGGAGAAACGGGATGCTTCCAGGACCCCATGGGCATCAGTTTCCTTCCCTTCCCTTCCCTTTCCCTTT

CCTCCCTCTTTCCCTTCCCCCTTTTCCTTTCCTCCCTCTTTCCCTTCCTTTTATTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC

TCTCTGTGTGTGTGTGTGTGTGGGGCGGGTTGGGAAGGCAGTACTGGGAATTGAACTTAGAGTCTTGTGCGTCTGAGGCAAATGCTCCATCACTGACCTA

ATCTCTTGTAGGTATCTTTAGGTCAAGGAAAAGTTTGAATATTTGTGGGCTGTAGATGGGACTTCTTTTCTTACTTTCTTTTTTTTTCTTCTTCTCTTTT

TGGGACTTATATCATTGTAATTTTGTGAGCAAATTCCTTAACCTTTTTTTTTTTTTTGGTGTGTGTATTGAAATTGGATCCATGATTTTGCATATGCTAG

GCAAGTAGTACTCTACCACTGAGCCACATCCCTAGTCCCTTTAGTTATTTAACTGACAGCAAAATTTAGGTATTTACATATTATAGAATGGTTAAAAAAA

CTGATTAATATATGTTTCTTTTTATGTTTGGGCAGTTAGTCTTCTATGGCTAAGGTCAGACTTGAACTTGATCTTCTGAACATTATTATTTATGGAGAGA

GAGAAAACACATGTGTCACAGTGTTTGTGGAGTTCAAAGGACAACTTTATAGGTTCCTTCTCCCTTTCCACTTTTCATGGATTGAACTCAGGTATTTAGG

CTTTTGTGGCAACAGCTTTACCCACTGAGGCATCTTGTTGGCCCCTGTATCCCCTCCCCCACCCATAAACAGTATCATAACTGAGAACTATCATGAACTC

ATGACCCTTCTGTCACCAGTTCTCCAAGTGTTGGTATTATAAGTGTGGACTGTGCTTGTTGTTGTTTTTTGTTCTGTTTTTCAAGACACAGGGTTTCTTG

ATGTAGTTCTGGCTATCCCTGTAACTTACTACAGTAAGTTAGATCAAGCTGGCCTTGAACACAGAGATCTCCCCCATGAGTGCTTAGATTAAAGGCATGT

GCCACCTCTGGCCTATCTTCATGCTCAGTTACTGTGGTGCTAAACATTATGCCAGGGTTTTAAGCACATTTGGACAACCAATTTACCAACTGAGCTACAC

CCCCCAACCCTATGTTTATGTTTTGTGATGAAAACATTAAATTTTTTTAAACATTTTACAGATCTATAGTGCATTGTTCATCTGTGGCAACATGTATATG

AACTTGGAGGATGTATATTATGTTAAGTGAAATAAATGAGGTTTG
Translation
 - UNI11841 - - UNI30984 - MLWQNLHQFGQKLVRRRPLAANEQSESSLSRCLTTLDLVSLGVGSTLGAGVYVLAGEVAREKAGPSIIICFLI

AALSSVMSGLCYAEFGARVPCSGSAYLYSYVTVGQLLAFITGWNLILNYVIG - UNI30984 - GAASVARAWSAAFDGLIGNHISQAMQTTFPIQVP

SFLAKYPDFFALGLVIVLTG - UNI30984 - - UNI34539 - GILALGARESALVTRVFTGVNLLVLCFVSLSGLINGKLHNWQLTEDDYKLALL

ESNNTDS - UNI34539 - SLGPMGSGGFMPFGLKGILRGTATCFFAFIGFDCIASTG - UNI34539 - GEEARCPQRSIPLGIVTSLFICFLMY

FGVSGALTLMIPYYQININSPLPQAFIHVGWGPARYAVAVGTLCALSSS SLIGSIFPVPRVVYSMAEDGLLFRKLAYVHPRTHTPVLATVLCGIIAA A

FMAFLVELSDLVDLSSIGTLLAYTLVTFSVLILR RYQPDQVLSSCKREKSESAAVELEPGLEPSSCMEPISPEGMPGIARTLCIPTNTTPTLRSGRIVY

GCASLLV VFLLMLLCLILTQWSTQLFSGDPVLIAMAASLLLLTVGVITVIWRQPQSTTPLHFK VPALPVLPALSIFVNIYLMMQMTSGTWFRFGIWMV

IG GFAIYFGYGIQHSLEEKNDQQPTASSSQTLQELQEHTPSVDLP

For any suggestions or comments, please send an email to unitrap@crg.es