Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054823 (Whsc1l1)
Chromosomal location
Chr 8: 26750756 - 26830139 (+)
Description
Wolf-Hirschhorn syndrome candidate 1-like 1 (human) Gene [Source:MGI Symbol;Acc:MGI:2142581]
RefSeq_dna
NM_001001735 
RefSeq_peptide
NP_001001735.1 NP_001074738.1 
UniGene
Mm.217337 
MGI
MGI:2142581 
Uniprot/SWISSPROT
Q6P2L6 
Human Ortholog
ENSG00000147548 (WHSC1L1)
Omim not available
UniTrap UNI27610
Vector Insertion
Chr 8: 26750755 - 26751798
Public Clones not available
Private Clones OST55254 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34851
Vector Insertion
Chr 8: 26751798 - 26758912
Public Clones IST10329B9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32210
Vector Insertion
Chr 8: 26760176 - 26770212
Public Clones IST14748E3 (tigm) IST12497H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033974
Sequence
TGTGTGAAGATTACTTATGCATCCTAAAGTTGCTATGGAAGTAAGCAGGACTTTTTTCTGGATGTGGTGGTGTGTTTCTATAATCTCAGGACCTGGGAGG

ATGAGTCAGGAGACTCCCCAGTTTAAGGACAGCCTGGGCTCCATAGCTGATGCTATCTGCTTTATGTCAGAATGATGTAGGTTTAATGTCTGCATATCTG

AATGTGAAAATTAGGTATAAAGAGCTTGTATAATCCTTGGTTGGCTTCTTGCCTATTAGAATTTTAATACTTTTTAATTCTCTTCAATTTTAGGCTCGAT

GAGAGAAAGGGAAAGTTAAGGATGCTGGAGCAGAACAATGGATTTCTCTTTCTCTTTCATGCAAGGGATCATGGGAAACACAATTCAGCAACCACCTCAA

CTCATTGACTCGGCCAACATCCGCCAGGAGGATGCCTTTGATAACCACAGTGACATTGTTGAAGATGGTGGCCCGACACCCTTTGAAGCTACTTTGCAAC

AAGGTTTTCAATATCCACCTACAACAGAAGACCTTCCTCCGCTCACAAATGGCTACCCACCATCAATCAGCTTGTATGAAACTCAAACCAAATACCCGCC

ATATAATCAGTATCCCAATGGGTCAGCCAACGGTTTTGGTGCAGTTAGAAACTTTAGCCCTACTGACTATTACCATTCAGAAATTCCAAACACAAGACCA

CATGAAATTCTGGAAAAACCTTCTCCTCCTCAGCCACCTCCTCTTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTTCGGTACCACAAACTGTGATTC

CAAAGAAGACAGGCTCACCCGAGATTAAACTAAAAATAACCAAAACTATCCAGAATGGCAGGGAATTGTTTGAGTCTTCCCTTTGTGGAGACCTCTTAAA

TGAAGTACAGGCAAGCGAGCACACAAAGTCTAAGCATGAAAGCAGAAAGGAAAAGAGGAAAAAGAGCAACAGACACGAGTCATCTCGATCCGAAGAGCGG

AGGTCACACAAGATTCCCAAGCTAGAGCCGGAGGGACAGAAT - UNI27610 - - UNI34851 - AGACCAAATGAGAGGGTGGACACTGCACCAG

AGAAGCCAAGAGAAGAGCCAGTGCTCAAAGAGGCCATCCCG GTTCAGCCAATACTGTCTTCTGTTCCAACAACAGAAACATCCACTGGTGTTAAGTTCC

AGGTTGGTGATCTTGTTTGGTCCAAGGTGGGAACCTACCCTTGGTGGCCTTGTATGGTTTCAAGTGATCCCCAGCTTGAGGTCCATTCCAAAATTAACAC

AAGAG - UNI32210 - GTGCCCGGGAATATCATGTCCAATTTTTTAGCAACCAGCCAGAGAGGGCATGGGTTCATGAGAAACGGGTACGGGAATACA

AAGGTCATGAACAGTATGAAGAGTTACTAGCCGAGGCAGCCAAGCAAGCCAGCAATCATTCTGAAAAGCAAAAG ATTCGGAAACCCCGACCTCAGAGAG

AACGTGCCCAATGGGACATTGGCATTGCTCATGCAGAGAAAGCATTGAAAATGACTCGGGAGGAAAGAGTAGAGCAGTACACTTTCATCTACATTGATAA

GCAGCCAGAAGAGGCTTCGTCCCAAGCAAAGAAGAATGTTACCTCTAAGACGGAAGTCAAGAAACCCCGAAGACCAAGATCTGTGCTGAACAGTCAGCCA

GAACAGACCAATGCTGGGGAGGTGGCCTCCTCACAATCAAGTACTGACCTTCGAAGGCAGAGCCAGAGGCGGCATACTAGCTTGGAAGAGGAAGAGCCAC

CTCCTGTTAAAATCGCCTGGAAAACAGCAGCCGCAAGGAAGTCCTTACCAGCCTCCATCACAATGCACAAAGGGAGCCTAGATTTGCAGAAGTGTAATAT

GTCTCCAGTTGTGAAAATTGAACAAGTGTTTGCTCTCCAGAATGCAACAGGAGATGGGAAGTTTATTGATCAGTTTGTTTATTCAACGAAG GGTATTGG

TAACAAAACAGAAATAAGTGTCAGGGGGCAAGACAGGCTTATAATCTCTTCACCAAGTCAGAGAAGTGAAAAGCCGGCTCAGAGCGCGTCATCTCCGGAG

GCAACATCTGGTTCTGCAG GCCCAGTAGAGAAGAAGCAGCAGAGAAGATCCATCAGGACTCGATCTGAGTCAGAGAAGTCCGCCGAGGTTGTGCCAAAG

AAGAAGATCAAAAAGGAGCAG GTTGAGACAGCTCCCCAGGCCTCCCTGAAGACCGGGTTACAGAAAG GGTCGGCGGACCGAGGAGCGCAGGGCTCTGT

CAGATTCAGTGACAGCTCCGTCTCCGCAGCGAAAGAGGAAACTGTGGACTGA
Translation
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNHSDIVEDGGPTPFEATLQQGFQYPPTTEDLPPLTNGYPPSISLYETQTKYPPYNQYPNGSANGF

GAVRNFSPTDYYHSEIPNTRPHEILEKPSPPQPPPLPPPPPPPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQASEHTKSKH

ESRKEKRKKSNRHESSRSEERRSHKIPKLEPEGQN - UNI27610 - - UNI34851 - RPNERVDTAPEKPREEPVLKEAIP VQPILSSVPTTET

STGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHSKINTRG - UNI32210 - GAREYHVQFFSNQPERAWVHEKRVREYKGHEQYEELLAEAAKQA

SNHSEKQK IRKPRPQRERAQWDIGIAHAEKALKMTREERVEQYTFIYIDKQPEEASSQAKKNVTSKTEVKKPRRPRSVLNSQPEQTNAGEVASSQSSTD

LRRQSQRRHTSLEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTK GIGNKTEISVRGQDRLII

SSPSQRSEKPAQSASSPEATSGSAG GPVEKKQQRRSIRTRSESEKSAEVVPKKKIKKEQ VETAPQASLKTGLQKG GSADRGAQGSVRFSDSSVSAAK

EETVD
Transcript ENSMUST00000084026
Sequence
ATGGATTTCTCTTTCTCTTTCATGCAAGGGATCATGGGAAACACAATTCAGCAACCACCTCAACTCATTGACTCGGCCAACATCCGCCAGGAGGATGCCT

TTGATAACCACAGTGACATTGTTGAAGATGGTGGCCCGACACCCTTTGAAGCTACTTTGCAACAAGGTTTTCAATATCCACCTACAACAGAAGACCTTCC

TCCGCTCACAAATGGCTACCCACCATCAATCAGCTTGTATGAAACTCAAACCAAATACCCGCCATATAATCAGTATCCCAATGGGTCAGCCAACGGTTTT

GGTGCAGTTAGAAACTTTAGCCCTACTGACTATTACCATTCAGAAATTCCAAACACAAGACCACATGAAATTCTGGAAAAACCTTCTCCTCCTCAG - U

NI27610 - CCTCCTCCTCCTCCTTCGGTACCACAAACTGTGATTCCAAAGAAGACAGGCTCACCCGAGATTAAACTAAAAATAACCAAAACTATCCAG

AATGGCAGGGAATTGTTTGAGTCTTCCCTTTGTGGAGACCTCTTAAATGAAGTACAGGCAAGCGAGCACACAAAGTCTAAGCATGAAAGCAGAAAGGAAA

AGAGGAAAAAGAGCAACAGACACGAGTCATCTCGATCCGAAGAGCGGAGGTCACACAAGATTCCCAAGCTAGAGCCGGAGGGACAGAAT - UNI27610

 - - UNI34851 - AGACCAAATGAGAGGGTGGACACTGCACCAGAGAAGCCAAGAGAAGAGCCAGTGCTCAAAGAGGCCATCCCG GTTCAGCCAAT

ACTGTCTTCTGTTCCAACAACAGAAACATCCACTGGTGTTAAGTTCCAGGTTGGTGATCTTGTTTGGTCCAAGGTGGGAACCTACCCTTGGTGGCCTTGT

ATGGTTTCAAGTGATCCCCAGCTTGAGGTCCATTCCAAAATTAACACAAGAG - UNI32210 - GTGCCCGGGAATATCATGTCCAATTTTTTAGCAA

CCAGCCAGAGAGGGCATGGGTTCATGAGAAACGGGTACGGGAATACAAAGGTCATGAACAGTATGAAGAGTTACTAGCCGAGGCAGCCAAGCAAGCCAGC

AATCATTCTGAAAAGCAAAAG ATTCGGAAACCCCGACCTCAGAGAGAACGTGCCCAATGGGACATTGGCATTGCTCATGCAGAGAAAGCATTGAAAATG

ACTCGGGAGGAAAGAGTAGAGCAGTACACTTTCATCTACATTGATAAGCAGCCAGAAGAGGCTTCGTCCCAAGCAAAGAAGAATGTTACCTCTAAGACGG

AAGTCAAGAAACCCCGAAGACCAAGATCTGTGCTGAACAGTCAGCCAGAACAGACCAATGCTGGGGAGGTGGCCTCCTCACAATCAAGTACTGACCTTCG

AAGGCAGAGCCAGAGGCGGCATACTAGCTTGGAAGAGGAAGAGCCACCTCCTGTTAAAATCGCCTGGAAAACAGCAGCCGCAAGGAAGTCCTTACCAGCC

TCCATCACAATGCACAAAGGGAGCCTAGATTTGCAGAAGTGTAATATGTCTCCAGTTGTGAAAATTGAACAAGTGTTTGCTCTCCAGAATGCAACAGGAG

ATGGGAAGTTTATTGATCAGTTTGTTTATTCAACGAAG GGTATTGGTAACAAAACAGAAATAAGTGTCAGGGGGCAAGACAGGCTTATAATCTCTTCAC

CAAGTCAGAGAAGTGAAAAGCCGGCTCAGAGCGCGTCATCTCCGGAGGCAACATCTGGTTCTGCAG GCCCAGTAGAGAAGAAGCAGCAGAGAAGATCCA

TCAGGACTCGATCTGAGTCAGAGAAGTCCGCCGAGGTTGTGCCAAAGAAGAAGATCAAAAAGGAGCAG GTTGAGACAGCTCCCCAGGCCTCCCTGAAGA

CCGGGTTACAGAAAG GTGCCAGCGAGATTTCAGATTCCTGTAAGCCCCTAAAGAAAAGGAGTCGCGCCTCAACGGATGTAGAGACGGCTAGTTGCACGT

ACAGAGACACATCTGACTCCGATTCTAGAGGACTGAGTGACGGGCAG GTAGGCTTTGGCAAACAAGTAGATAGCCCGTCAGCTACTGCTGACGCAGATG

CTTCTGACGCGCAGTCGGTGGACTCGAGTCTGTCACGGAGAGGTGTCGGCACGAGTAAGAAGGACACTGTGTGTCAG GTCTGTGAGAAGGCTGGCGACT

GCCTTGTTGCTTGTGAGGGGGAGTGCTGCCGACACTTTCACGTGGAGTGCTTGGGACTGACTGCAGTCCCTGAGGGCCACTTCACCTGTGAGGAGTGTGA

GACTG GACAGCACCCATGTTTTTCATGTAAAGTGTCTGGTAAGGATGTGAAACGTTGTTCTGTTAGTGTCTGTGGAAAGTTTTATCATGAAGCCTGTGT

CCGCAAATTCCCCACTGCCATCTTTGAGTCAAAAGGATTCCGCTGTCCCCAGCACTGTTGCTCTTCCTGCTCTATGGAGAAAGACATCCACAAAGCAAGT

AAAG GCCGCATGATGAGGTGTCTGAGATGCCCGGTCGCCTATCACGTTGGAGATGCGTGTGTCGCTGCTGGAAGTGTATCTGTGTCCTCGCACATTCTC

ATCTGTAGTAACCATTCCAAGCGGAGTAGTCAGTCTGCTGCTATAAACGTAGGCTTTTGTTTCGTTTGTGCCAGAG GGCTGATAGTTCAGGACCATTCA

GACCCCATGTTCAGTTCCTATGCCTATAAATCCCACTACCTACTGAGTGAATCAAACCGTGCTGAGTTGATGAAATTACCTATGATTCCTTCTTCGTCAG

CTTCCAAAAAGAGATGTGAGAAAG GTGGAAGATTGCTCTGCTGTGAATCGTGCCCTGCTTCCTTCCACCCAGAATGCCTGAGCATAGACATGCCAGAAG

GCTGCTGGAATTGCAATGACTGTAAAGCTGGCAAGAAACTGCATTACAAACAGATTGTTTGGGTCAAATTGGGAAATTACAGGCAAGTTTT ATGGTGGC

CTGCAGAGATTTGCAGTCCCAGGTCTGTGCCGCTGAACATCCAGGGCCTTAAGCATGACTTGGGGGACTTCCCCGTGTTCTTCTTTGGTTCTCACGACTA

CTACTGGGTTCACCAAGGCAGAGTGTTCCCTTACGTTGAAGGAGACAAACACTTTGCAGAGGGACAGACTAGCATTAACAAGACCTTCAAAAAAG CACT

GGAAGAAGCTGCAAAACGTTTCCAGGAGCTGAAAGCCCAGCGTGAAAGCAAGGAGGCTTTGGAGATGGAGAGGACCTCCAGGAAACCCCCTCCCTACAAG

CACATCAAG GCCAACAAAGTCATAGGGAAGGTGCAGGTCCAGGTGGCTGACCTGTCGGAGATCCCCCGCTGTAACTGCAAGCCTGGTGATGAGAACCCG

TGTGGCCTGGAGTCGCAGTGTCTGAACAGGATGTCACAGTATGAGTGTCACCCGCAGGTGTGTCCTGCTGGGGACCGCTGTCAGAACCAGTGCTTTACAA

AGAGGCTGTACCCCGATGCAGAGGTCATCAAGACCGAGCGGCGAGGATGGGGCCTCAGAACCAAAAGAAGCATCAAAAAG GGGGAATTTGTAAACGAGT

ATGTCGGTGAATTAATTGATGAAGAAGAGTGCAGACTCCGAATCAAGCGAGCCCACGAGAACAGTGTAACTAATTTTTATATGTTAACTGTTACCAAG G

ACCGTATAATTGATGCTGGACCAAAGGGAAATTATTCTCGTTTCATGAACCACAGTTGTAATCCAAACTGTGAGACACAGAAGTGGACTGTAAATGGAGA

CGTTCGAGTTGGACTATTTGCTCTTTGTGACATTCCTGCAG GGATGGAGTTAACGTTTAACTATAACTTGGACTGTCTGGGCAACGGCAGGACAGTGTG

CCACTGCGGAGCAGACAACTGTAGTGGATTTCTAGGAGTGCGGCCAAAG TCTGCATGCACATCAGCAGTTGACGAGAAGACAAAAAATGCCAAGTTGAA

GAAGAGGCGGAAAGTCAAAGCGGAGGCAAAGCCAATCCATGAGGATTATTGTTTTCAGTGTGGGGATGGTGGAGAACTGGTCATGTGTGACAAGAAAGAC

TGTCCCAAAGCTTACCACCTCCTATGCCTTAACCTGACTCAGCCACCCCACG GAAAGTGGGAGTGCCCGTGGCATCGGTGTGACGAGTGTGGCAGTGTA

GCCGTTTCCTTCTGTGAATTCTGTCCACACTCATTCTGTAAGGCTCATGGAAAAGGGGCTCTGGTGCCCTCTGCACTAGAAGGTCGTCTCTGCTGCTCCA

GCCACGACCCTGCATCTCCTGTGTCACCAGAATACTGGAGCAAGATCAGATGTAAATGGGAATCCCAAGATAGTGGAGAAGAAGTAAAGGAGTGAGCGGT

GGTGACCTCCTCCCACTGCTCTCAGTAAAGAGGCGCAGAGAGGCCACGCCTGCCCTGCCCTGCCGTCAGTCCGCCTTGACGGAGATGGGCGCCAGCTCAC

ACAGGCTAAAGCACTTGCTGGTGTCTGGGTTTTCTATTTTGTTGTTTGGGGGATAATTTTGTGGACAGCAAAATTCCCTTGGTCTCTTCTTGCCTTTCAT

TGTGCTTCAGTGTCTTTGCAATCAGCAAAAGAGGTGTCCTTGTTTTTAGAGTTGAGAGAGAGAAAATTAAAAGAAAGTTTTGTCTATACGATCAGTGTAA

AGCCTAAGATGTACTCCCGGGTTATGTAAAGTGAAAGTAGTCATTCCTGTATTTATTTTCATTTTTAGGTATTCTGAGAAGTGTAGTTCAAACAATCTAA

CCTCCATGAGTGCTCGTGCGTGTACGTGCGCGTGTGCGTGTGTGTGCAAGCGTGCATGACTGTCACCTTTATATACCTCTTTCCTGAGCCATAGAGTGGC

TAACTTCTCTTTCCTTTTTCCCGGGCCTTTTCTCGGGTCAGAGAAGGCTCTCAGCAAGTATTCAGACTGGCCTCTTGAAAACAAACTCCTTGACAGCATT

TACCTCTGTGGTCTTAAACTGGGTGGGCTTCATGGTGCGCCAACTCTACGTAGAAATATCTTAGAGGGACAAGGAGTGAGTGCATTCTACTCATTGTGAT

TTTCTGAAACATTTGAGGGATGTGAATACATAGGGGAATGCTCATTCCTGCTGTCCTGACCACTGGCAAGAGGCTAAAGAAAGATAAGGCACAGACCAAA

CATTGGATCATATATGCACCATTTTCTGACCAATTTAATGTAGACTCCAGTCTAACCTGGAATTTAAGGGCATTTTATTTTCTGTCTTTCCCTCTGCCAA

TCATGTTTCCTTTGCCAGCTGGGTCACTCAGTCATGTTTCCTGGTAAAGCTATATAACTGAATCTGAATTATATGAAATAGACTTTTTCAGTTGATTTCC

TAACTTAGGGATGATGCAAGTGGACAGAAACATCCCTAAGTTATATGTGAACCATTTCTACTTAGTATTATGCAATACTTAAGACTGTCCCCATTGCATA

AGGGGAAGAACTTGCTCTTTTACAGGGTATGTAGGAGCCACAGAGATGCTCCATGTAGAAAGCACTTGAAACCGCCCCCCACAAAGTCAGTGTTTGCAAA

CATGGCTGTGAGGTTTGAATAGTACAGACCCAAGCATACCAAGGCGTCGGCCCGCAGAATTCACTTGCATCTAGCACTTAGGATCTAGTCCAGTATTACT

TGTGTGAAATCATGTCAGACATGGTAACATTAGACTAAATAAAAATCTAGTGTTACCATGAAATATGAACTTCCTCAGTGTGTTTCAACTGCTTACTGGA

GGTACCCAGTAGGCTCTCTTCTCCTCAAGAACCTATACTTTACTAACGTAGGGCACGAGATGCTCTATGACACCCTGTAGTTATGTTAGGTGCGTTTGTC

CTTTTTTTAGTTTTTTACAAATCAATTCAGACCTCATCTCTGGACAAAAGAAAGAGCAATTTTGTGCCTCTTTTTTTTAAATATATATAAATGTGCAATT

TATAGGCAACAGACACTACAGTTCCTCTCTAAGCTCCTGAACTGCCATTTACCTAGTCTAGCACTTGTGGTAATCCCGCTGGCTAGACAAGCTCCTGTGA

GGAGGGAGACAGGACGGTACCCAGCACCCAGTGCAGTCCCTACGACCGACTCGAACGAAGCACAGCCCACGCAAACACTAAACTCTCTGCTCTTGAGCAA

TTATGAAGTTTGATGTCCTTTAAAACAATAATGTAAGAGTATCTGGGTTTTGTCATATTAAATTTTATTTTATACAGACATAACATTTTTTAAACTTGTT

GATAAGCGACTTCCTTTGATATTCCAAATGTAACCCTCATGAGAACAATGTCCGATATGAGATTGTATCTTGTTTCCTTTTTGACCTCGTGCTTTTTAGT

ATCTGATAACTTTTATAGAGTAAGCCCCAGGGTTCATCATGTATTTATAAATACCCTACCCTGACCTATCTCTCTCCTGCTTCTCTGCTATGGCTCGCTT

GTTTTTATATCTATAAAAGGACTTTGCACTTTTCAGATCTTTTCCTACTAGATGACTAACAGGCTTGCTCTCAGAAGCCTGCCTGCTCCAAGCCAAGTGC

AAGGGCGACTGCCTGTGCCATCATCGCAGCCTGGGTCTTAGAACTGAGGGTTAGGAAGCAGAACGTTGGCTGACTGGTGTAAGTATACGTACACCGTCGG

TCGTTTCATGTCCTGTGTCAGTGACATTGCAAGGCACTGTGCTTACTCGGAGCCTGAAGCTGCTTGGTGGTAGCTTTTCAATATGGTTTAGGTATACAGC

ATTTGTGGTTGATTTTATTCAGCCCAGAAATAAAGGACTCAAAGCAGCATGGGATACTAGTGGTATTTCCTAACCTCAGGAGGAAGATGAGAGTTCTGGT

TATCAGTGGAAAGCTTTAGAAATTGGGCTGGAAAGAGCTAGAGATGATAGCACGAGACCATCACAAGCACTGTGCCTTGTAGGTGTCGCTGGGCCGCCAG

GGTAGCTGCCTGTGTCTGGCCAAGCAGGATGGGACCAGTGCTCGTCACTGCCAGTGTGCTGCAGTAACCTCTGATTTCAGTCTCCAGTCAGGGTGGGGAT

CAGAGTGGAGTAGGTTTTATCTTCACTTTTGCTTTGCAAGCCCTACCTACTCTTATTTTAATTCTCAAAAATTACCTTTCCTAAGCTGTAGAATAGACTT

GAGTTTTCTGTGCGTTATATAAATAACATATATATATATATAAATATAAAATGTTTTATATATATAAGTGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGT

GTGTGTGTGTGTGTACACATACATACTGAGTTAGGAAGTATTTGAAACTAAAGAGATAATAAGGGCCTGCAGCCCACTGCTTCTGTCAGTGTCTCCCACT

GCAGTGTTTGCGGAAGTGTGTGTAACTAATATGGATCTGAGATACTGAGGGTCTGTCTGCTCATGTGAAATACTCGGCTGGACTGGTAGGCAGCTTTTAT

GCAGTGGCTTCTTTTTTGAGTACTTTCTTACTGTTTCGGGTCAAAGCCAGACTACAGTTTGAAGTCCTCCCATTATCTGTTCAGAACATAGACCCGGCTC

TCCAAGACCTGCCGCTAATCTTGTCAAAACAACACTCCTCTTGCAGCACTTCCCCACGGAGCTAAAATGCTGCCAACCACATGCCATGCCCTAATGGGAG

AGGGAGACAAATTGCCTCAGTCTCCCTGAGCGTGAGCAGCGTATGGTCTTTATGTTTCTCAAGGCACTGCTTCATTTCTAGACTTGAATTGCTTTTCACG

TGGCTGTTGCATCTGACCATCCCGGACTCTGCCAGGCTGCTAAGGGCAGCGTGGAAGTGATCGGATGGCAAGGTCCTCAGGAAGGACCGCCCACACTTGG

TCTTTGCTTATTTGTAACAGAATGGTTGGTTACGGAAAGGTCTGGTCCCTCCTTGGATGGACGAAGGGATCCGTGTAGGCAGCTTTGCAGTGGATTGTTG

TATGGACTGAGGTGTCACAGTTTTCACCTTGGGTGGGGGAATGGGAATGTGGGGAGAAAGGGAGGGAAAGGTACAGTGCAGTTCCCCTAACACCGAGACC

CCCCCACCCCATTTGAATTCAGGCTCTTCAATTCCTTGGGACTTCAGATTCTCATTTTATATTTTACAGTTTTAAAATTAAGACATGGAAAGCATCATGT

TGTATACTGTCAGATATGCAGTCCTCCCGACGGGAGCACGGGCATCTTAGGTTTCTTGGCACCTTTGAGGTCGGAGCTCGTGCATGTTGAGAAATGATTT

CCCTGCGTCTTTGTTTTGCCTTTTTCTCCTTTCCTTGCCTCACCCCTGGGTAGCTGGTCTTTCTGTTTAACATATGCTTGTGTGGGGGGAAGAGGGCGCA

CTTATGTTATACTCCTAAAATGCTATGTATAACCTTTGTTTCAAAAACCCATTTCCACTGGGCATGGTTGCACACGCCTTTAATCCTAGCACTCCAGAAG

CAGAGGCAGGAGGATCTCCGAGAGTTCAAGGCCTACCTAACGCTTCCCAGCCAGCCAGGACTATGTAGAGAGACCCTGTCTCAAAAAGGGGGGGAAAATC

AATTGTTTGGCTTTTGTCAATCCATTGCAAAAGTGGCAGATGTGAGCGCTTGTATTTGTGTATGGGGGAGGGGGGAGAAAAGTATTGTTTGTCCTTCAGT

AGGCTCTGAAAGTCATTGACTTGTAAGTTCAAGGGAAAATAGAAGTTGCCAAAGTCAGTATTCGGTCCTTGGTTTTCTTGTGACTTCACTGCGTCCGTTA

AGGGACGAGAAGCCTTCCTTACCTGCTGACTGAGCCTTGCTCTGTGCAGATGGCTTTCAAGTATCTGCCATTTTGCCTCAACAGGGAATTCTTGTCAGTT

AAAGGGAATGAGGGAATTACACTTTTGTTATCAATTAACATCTCATTTTTTGTACCCTATGGTAAGTAACTGTATTGCCGCTAATAACCAAGTTGCTAAC

TGATTACAGCTGGCTAAAAAGTTCTTTTTATATACAAAGATTTGTGTATTTTCAACTGCTATGGCAAATTCATTTGTGTCCATTTAAATATTACACAATA

AACACATATCTGCAGATCCCACCCTCACCTTGTGTTCTTTGAATAAAGTTCTTGATAGATTGTTTACATCTGTATTTACCTGTAATGAACGCTGTAGACC

TGTGAAATATCAAAGTGTCAACATCCATTAGTCAGTCTCTTTAGTTTCTGTGACTTGGCGCTCCTAACACTAAGGGGTTAGTGTTAATGTTCCCCAGGGG

TATTCTACTAGGGCATTACTGTTTAATGACTTCAAAATATAGTTTAAGGATTTTGTTTATTGACCAATGTCTTATTGCAAAGTATGAGCCTACCATCTTA

GTTAACCTGTACATATCTGTTAACTAGTGTAGTGTATGTGAGATTGCCTGTAACATTTGAGCTTCTTACTGATGTGTGCTGGTGGGACAGGTTTTGTACA

TTGTATTTACTGGAATCCTGCCTTTTTAACTTACAGATACTTTAGAATTCAAATATGTTTTCTGCTTCTGTAAGAATGTGGGAAAGCTTTTAATGGCATT

CCATTGATTTCAGGTCTTGCTTGAGGTTGACTTTAATAAATTGTCCTGTATGGTCTACTTAA
Translation
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNHSDIVEDGGPTPFEATLQQGFQYPPTTEDLPPLTNGYPPSISLYETQTKYPPYNQYPNGSANGF

GAVRNFSPTDYYHSEIPNTRPHEILEKPSPPQ - UNI27610 - PPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEVQASEHT

KSKHESRKEKRKKSNRHESSRSEERRSHKIPKLEPEGQN - UNI27610 - - UNI34851 - RPNERVDTAPEKPREEPVLKEAIP VQPILSSVP

TTETSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHSKINTRG - UNI32210 - GAREYHVQFFSNQPERAWVHEKRVREYKGHEQYEELLAEA

AKQASNHSEKQK IRKPRPQRERAQWDIGIAHAEKALKMTREERVEQYTFIYIDKQPEEASSQAKKNVTSKTEVKKPRRPRSVLNSQPEQTNAGEVASSQ

SSTDLRRQSQRRHTSLEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTK GIGNKTEISVRGQD

RLIISSPSQRSEKPAQSASSPEATSGSAG GPVEKKQQRRSIRTRSESEKSAEVVPKKKIKKEQ VETAPQASLKTGLQKG GASEISDSCKPLKKRSRA

STDVETASCTYRDTSDSDSRGLSDGQ VGFGKQVDSPSATADADASDAQSVDSSLSRRGVGTSKKDTVCQ VCEKAGDCLVACEGECCRHFHVECLGLTA

VPEGHFTCEECETG GQHPCFSCKVSGKDVKRCSVSVCGKFYHEACVRKFPTAIFESKGFRCPQHCCSSCSMEKDIHKASKG GRMMRCLRCPVAYHVGD

ACVAAGSVSVSSHILICSNHSKRSSQSAAINVGFCFVCARG GLIVQDHSDPMFSSYAYKSHYLLSESNRAELMKLPMIPSSSASKKRCEKG GGRLLCC

ESCPASFHPECLSIDMPEGCWNCNDCKAGKKLHYKQIVWVKLGNYRQVL LWWPAEICSPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYVE

GDKHFAEGQTSINKTFKKA ALEEAAKRFQELKAQRESKEALEMERTSRKPPPYKHIK ANKVIGKVQVQVADLSEIPRCNCKPGDENPCGLESQCLNRM

SQYECHPQVCPAGDRCQNQCFTKRLYPDAEVIKTERRGWGLRTKRSIKK GEFVNEYVGELIDEEECRLRIKRAHENSVTNFYMLTVTK DRIIDAGPKG

NYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAG GMELTFNYNLDCLGNGRTVCHCGADNCSGFLGVRPK SACTSAVDEKTKNAKLKKRRKVKA

EAKPIHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPHG GKWECPWHRCDECGSVAVSFCEFCPHSFCKAHGKGALVPSALEGRLCCSSHDPAS

PVSPEYWSKIRCKWESQDSGEEVKE

For any suggestions or comments, please send an email to unitrap@crg.es