Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000054939 (AC129021.4-202)
Chromosomal location
Chr 16: 3847223 - 3858880 (+)
Description
zinc finger protein 174  [Source:RefSeq peptide;Acc:NP_001074686]
RefSeq_dna
NM_001081217 
RefSeq_peptide
NP_001074686.1 
UniGene
Mm.244261 
Human Ortholog
ENSG00000103343 (ZNF174)
Omim not available
UniTrap UNI33739
Vector Insertion
Chr 16: 3849571 - 3854210
Public Clones IST14598H2 (tigm) IST11005E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041778
Sequence
GGGCGTCTCCGTGGCGGGGCTCCGGCTCCTCCCCTAGACTGTGCTCTAGGGTTCCCGGTGTCCAGTCTCTGGCAAGGTGGGTCACCTGCAGGCGGGCACT

GGCTTCTGAGCTGCCTCAGAACGTGGTGTCGCAGGTGGCTACTGGAACTGACACCCAACACTGCTGTGGAGCTGCGTGTCCGAGCTGACTGGGCCGCGGA

GCCGCACTCCCTATCCTTAACCACGCATTGGTCGCGCTGTGGCCTTGGCTCTGCTTCGCTCAGAGGTGCTGGATCAGGTCGGTGTCTGCCAGATGCCGGA

GAGTTGGTGCGAGCTACCCACAAGATGATAGCTTAAACTTTCCCTGGGGATTCCTCTACCGGCCCTAACGCGTTGTGAATTTCGCCAGATACAAAAATAA

AATATTCTCTCCAGTGCCCTTCTGGGGTATTATGACTTTTCTCCTTAAAAACTGACGAAAAGACCGGGAACTATTTTGTTTTCAGAGTCTGGGATAAAGA

CTAGCAAATGAGAAAGCTATGTCTTTGCAGTCCTTCCAGGGAGGCTTCGTTCCTAACATTTTTCTAGCCTTCAGATTTCTCCAGAGCAAGGACCCAGAAG

ACATAATCAGTTTACCATTAGAGTGACACATTGTTCCCAGAGCCCCCAAAATGGCAGCTAGAATGGAGATAACTTTGAGCACCCACACTGAGGATTCTGA

CAAGCAAGAGAGACACATAATAATGAAGCTGGAAGAAAACCGTGGCCCCCCTCAGCAAAAAGCCTATCCTGACCCTGAGCTTTCCCGCCAGGGCTTCAGA

CACTTTTGCTATCAAGAAGTGTCTGGGCCCCAGGAAGCGCTCTCCTGCCTTCAACAGCTCTGCAGACAGTGGCTGCAGCCTGAACTACACACTAAAGAGC

AGATTTTGGAGCTCCTGGTGATGGAGCAGTTTCTGGTCATCCTACCTCCAGAGATCCAGGCACAGGTCTGGCATCGGTATCCAAAGAGCAGCAGGGAGAT

TGTGACTCTGGTGGAAGATTTGCACAGAACATCCAAAAAACCAAAGCAGTGG GTGACTGTTTGTATGCAAGGGCAAAAGGTGCTCTTGGAGAAAACAGG

AGCTCAGCTTGTAGAACAAGAACTTCGAGACTTTCAACCCCAAACTCCCAGCAGAGACATTCAGGAGGACTCTCTGGAAGAGCCTTCCTGCGAAGGATCT

CACGAGCAGCTGAGTCCTCACCACTGGGAGAAGACTGTCCTCCAGGAACCAGTCCTCAGATTGACTGAGACAG - UNI33740 - AGTCCTCCAGAAT

GAGAGGTGACAAGGAAAACCCGAAACAGGAGGAGGCAAGAGGAGCAAAGGCATGCACAGTCTTACATGGAAGACCTAAAGGGGGTACCCTGCACAGCCCT

GAGCCAAGAGGGGTGACTGCAAGTGATGCCCGATTGTTGCAATGGCAGGTCAGACCCCCACAATCTCCCAAGTCACTTGCCCACTACCAGAAACATTGCA

GAGAGCTGGAATATATCAGTAATCCCCTCAGAGGTCACCCGCTGAGAGAGTTAAAGAGAAGCAGAGGAGGCCGAAGAAGAAGCCTGAGTGGCCTCCTGCA

GTGTCTTGGTCACCAGGCAGCCCACCCAGCCAAGAAACCTTACAGCTGTGAAGATTGTGGGAAAAACTTCACGTGGAATTCAGAGCTGAAGCGACACAGG

AGAGTGCACACCGGGGAGAGACCCTACATCTGCGGGGAGTGTGGAAACTGCTTTGGGAGGCAGTCAACTCTGAAACTGCACCAGAGAATCCACACTGGGG

AGAAACCATACCAGTGCAGCCACTGTGGCAAATGCTTTCGCCAAAGCTCCAACCTCCACCAGCACCACAGGCTCCACCACGGGAACTGAAGCCATGCTGT

GTGTTGTAGAGTCCTAGGGAAAGGCTTTTGGTCTCTCCCTTCTCTTACTTGCCTGTAAATCGCAAAGTATCTTTTGTGACTTACAAACAGAGCAAGTGGC

CTTTGGGAAGTGATGGGTCAATAATCAACTTGTAAGGAGGTCAGAAAGAGGCTGATGGGGCCTGACTATAAGGAAAGCTGATCTGGGTCTTGGAGCACAG

AGAGCTGCAGTCTCGGCAGAGTGAGGACTAGTTACTGAAGAATAGTCAGAATGAGCTGCAAGTGACTTTAATTAATTAATCTTCATCTTCTAAAATACAG

TTGTTTTCATGTGTACACTTGAGCAGTTGATGAGAATGCAAAGAAAGCATTCACCGGAGAGTCCTCTAAGAGTCTTTCTGCAACTGACTTTTTTGGTAGT

GGTAGTTTTTAATTACTTTTATTTATTTTTAAGACCGGTCTCTCTATATAGCCCTAGCAGTGCTGGAACTCAACTCTGTAGACCAGGCTGGCCTGGAACT

CAGAAATCCACCTGCCTCTGCCTCCCAAGTGCTGGTAAAAAGGTATGTGACCCCAAACCCTGCTATAACTAAAGACAAATTGAGAATGTGTGTGTGTGTG

TGTGTGTGTGTGTCTGATTAAAAGTTTCTAAGTAAGTAGACAGTACTTTTATTTGAATTATATTTGAGGGAACTTTTTATGTCAAAGCACTTTTGATTTA

CAAAAGGTGTTCCACCTCCAGCCCACGATATAAGGGAAAGCTCCCAAGAGAAGTAAGTACTGCTCTGGTGGACAGGGGAATTCTGCCTGTTCTTAAATAA

GCCATTAGCTTTAAAACTGTGACTAGTGTGTTCACGGTGTTTACAATTGGATTATGGGAAGGGTTATACAATTAAGTGACTCCAGGAAAATTATTGAAAT

AGATTAATTTATGATAGGTAAATTGTACCTCCATAGCCTTTTAAAATAACAGAATATTTATATAAAATGTTAAGAGTTCCAGAAGTGGGTCTAGGAACCT

TCCCATGCCAAACTCTTGTTTTCTTAAAGTAGAAAGTAGAGCCCAATCAGTAATCACCCTAGGGAAGGCACCCTCTTCCTCCATTTCGGCAGATATGTGT

AAGTAGGATGTGGTGGCCATTCTTCTGAAGGCATCAATGCCAAGTCACTGCCTTTATCTTCAATATTCAGCTGGGCCTTACCTCTTCCCCAGCCCACACA

CCACTGCTAGCCAGAGCCTTTATAGTTTATACACATAGACACATACACACACACAACTTTCCTCTAAGCCACCTTCACTGCTGTCTTGTAATAACTTCTT

AGTCATGTCTGAATTTGTTTTCTACTGGTGCTATAACAACTGAATGCAAACTTGGTGGTTTAACACAAAACTTCGCTTATACTGCAAGTTAAAGGTCTGA

AATCAGCCTCAGCCATAATCTCCTTGAGCAGGGTTTCCCATTGGAGACTCTGAGAGGTAAATTGGTTTCCTTGACTTTTTCAGCTTCTAGCAGCCCACTC

CATTCTTGGATGCTTATATTGGGTATAGCAGGATAATCTCCACATCTCAAGATCTTCAGTAATACTTACAAAATGTTCATTTTGCCATTTAAGGGATCAT

CTGCTGGTTCCAAGGATTAGGATATACGTGGAGGACCATCATTTGGCCTACCTTCCATCCATGTATGTCAACTTGGTCACTAAAAGGGGATCTCCAAAAG

AGATGGAACATAGGATTGTTTGTAAGGGTTGGCACGGGGGCAATGGCTAGAGTTTTGCTACCTGGAATCTTTCATAGTATGTTTCCTGTCTTCGGATTAC

ACAGCAGTAATCGTTCGGCGTCTTTGGGCACCTGTTCAAACCTTTAATTTATGTGACAAACTCACAGTTAACATTTTTCTTTTCCAAACAGTGTCAAGGC

CATGCTGCTGCCTTGCCTGCTTGTCCCCAGCCCAGTTTTCCTTTGTATGAGGCTCACCTCCCAACAACGGATGGCATGAGGGTCCAATGGCACAGAAGGC

TCTTGGGTACTGCATTCAGATATAGGGGTTCCCTCATCTCCTTCATCCATTCATGCTTCCCCAGAGCCTCCGCACAGTCTTGACCTACCTACTTTCCTTG

CGGCCAGCTTCCCTTTCCTGGACCCCAACCTAAGAAAATAACCTATCATGCAGCTCTGGCTCCTACCCATCCCATTGGCTCTGCCATATTTCTGGGTCCT

GCCTAGCACATACTGGTGTCAGCTTAGGGGTGACTCCTGCTTTCAGTGTTTGATTCCCCGAGTTAGCCCCAGGGAGACCCAAGGAGAAGGGAAACATCCC

CAGGTAGTGGAGGTCTGTACACCAAAAGAACCCTTTTTCATATCCAGCAGGTAAGGTGCCAATCAATCCCACAGTACAACTGTCACTCCAGTAAGACTGG

CAGTGACTCCTCACAGTGCAAGACTGCTCCTCAAACTAAAATGTTTCCGTTATTGCTTCATTGAAGTATTACACGTACCAGAAAACTTGTGCACTTATAG

TATACGGTTCAGTGTTTACCATACAGCATTTAGAGCTGTGCCTCTGTCACTCCAGTCTTGTTTTAAGATACTGTCAGTGTCACAGAGAAGTGAAGCTTAA

ACATTAGCAGTCATTGCCTGCTCCTGTCACAGCTTATGCCTCTGGAAAATATCTTCTGTGCACACCAGGTGTGCACTGTGTCATACGTCAACACTTTCTT

CCCTAGTCCTGTTGTGTTGTGTGAAGGGGCTTTCAGTCCCTCTATTGGTTGATGGAATTGTGTAATTGCACCCTGGTTATTGTGAATAGAGTAATGTTGT

TCTAACGTTATATCCAGGTTTTTATGTTTCACTTCTCATGGGTACATGCCTAGGGGCCGAGCAAAGCTCCCTGCTAGGCCATGTGATAATCCTGCTGATC

AAACTGTCTCCAACGTGCTTACACTACACTTTACACTTGCCAGTTTCTGCACACCTTTAACATAATTACTGTCTTGTTTCAGATTTTGGCTTTCTGAAGC

AGGCTTTCATGTCTGGCATAGAACTCACAATCCTAGCTGACCGTGACCTTCCTGCCTCCACCTCCCAAGTATCAAGGTTACAGGCATGTGTCACCATGTA

CAGTTTTCATGGAATCTGTCTTTGTGATTATTGTTATCCCAGAGTAAAGTGGTCTCTTTTATGGTCTTGATTTTCTTTTTCCTGATGACTAATGATGTAT

TTGTTTCTTGTCTTTATATTTGCTTTGAAGAAATGGCTATTTAAAATTCCCCTCCCCTCTGGTGTTTTGAGCCAGGATCTTGCTGTATAGCCCTGGCTGG

CCTAGAACTCACTACATAGATCAGGCTGGCCATGAGTTTGAAATACTGCTCCTGCCTGTTTGTCAAATCTTTTGCTCTCTGTTGTTTTCCAGCAGGAGTC

TTTGCTCTGTAGCTTAGGCTGGCTGGGCTTACAGCAGTCTTCTTGCCTCAGCCTTGAGTCCTGGGTTTACAAATGTGAGCCACCATAACTATCTCTGTGG

CCCTTTTAAAATGGGCTATCATTTTTTATTGCTGGGTTTTAAGAATTCTTTAAATATTCTGGGATGAAGTCCTTATGATGAAGTCCTTGAAAACAGTTTC

TCCCATTCTTTGGAAATACATTCTTGTGTAATTGTTTTGTTTTTGCAGTGAGGGTTGATACAATCTCCAGCATAACTCAGGCTAGCCTCAAACTTGCAAT

CCTCCTGTCCTAACCAGGATGGGATGACAGATGTACACGCGTGCCCAGCGGTACATATCTGTAATGAAAACAGCTGTTACTTGTCAAAATACAAGGAACC

AAATTCTCTGTTTCTAAATTGCCAGTGTAAAGTAGCCTGACATCCCTGTGATTTAATGAAATTAAGGACCCTTGGAGCACAATTTCTATCATTCCTCCAA

GCCTGTTGGGTCACATCACCCACAGACTTCCCTGTGCCAGTCATGCATGGCTTGTGGTTCCTAAGGAAAATTTAAATATCTATTAAAATAGTTCTATTAG

TCTTTGGAATAAACATTTTCCCACTGAAATAAAGATGGTATTGATTACTTCATAAGC
Translation
MAARMEITLSTHTEDSDKQERHIIMKLEENRGPPQQKAYPDPELSRQGFRHFCYQEVSGPQEALSCLQQLCRQWLQPELHTKEQILELLVMEQFLVILPP

EIQAQVWHRYPKSSREIVTLVEDLHRTSKKPKQW VTVCMQGQKVLLEKTGAQLVEQELRDFQPQTPSRDIQEDSLEEPSCEGSHEQLSPHHWEKTVLQE

PVLRLTETE - UNI33740 - ESSRMRGDKENPKQEEARGAKACTVLHGRPKGGTLHSPEPRGVTASDARLLQWQVRPPQSPKSLAHYQKHCRELEYI

SNPLRGHPLRELKRSRGGRRRSLSGLLQCLGHQAAHPAKKPYSCEDCGKNFTWNSELKRHRRVHTGERPYICGECGNCFGRQSTLKLHQRIHTGEKPYQC

SHCGKCFRQSSNLHQHHRLHHGN

For any suggestions or comments, please send an email to unitrap@crg.es