Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055022 (Cntn1)
Chromosomal location
Chr 15: 91958619 - 92170545 (+)
Description
contactin 1 Gene [Source:MGI (curated);Acc:Cntn1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI37843
Vector Insertion
Chr 15: 91992093 - 92046746
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068378
Sequence
AGCATTGACTCCAGCCAGCCAGGTTCGGGAATGTAAATCCACAGCTCACAGCCCAGAATGCTTTATTTGAAAGTATCGCTATGTGGAGATCCAGCTTTGC

AGTCTTATAACCTGTTCTTTGCAGAAGGTTGGCTGAAGGATGGGAGCGGCTATGCCTGCCTCTGAGGTCACAGCATGAGGTCCTTTTAACTTGCCTTCTG

CTGCAGAAGAGAAGCCCATTGTGTCATAACTCTCCCTGAGTCTATTCAAAGGGGCAATTTGAAGCAGATATTATAGCAAGATCGGCAGATGATTCAACCC

ACACG - UNI37843 - GTCTTTCATAGTACTCAACTGCCATAAAGCTTTCATTACTTTTGGAAACTGACCCATCTATTCAACAAAAGATGAAAATGC

CATTGCTGGTCAGCCATCTCCTGCTAATCTCCTTAACATCTTGTCTAGGAG ACTTTACCTGGCACAGAAGATATGGTCATGGAG TGTCTGAGGAGGAC

AAAGGATTTGGGCCCATTTTTGAAGAGCAGCCAATCAATACCATTTACCCAGAAGAGTCACTGGAAGGAAAAGTGTCACTCAACTGCCGGGCACGCGCCA

GCCCATTTCCAGTTTACAA ATGGAGAATGAATAACGGGGACGTGGACCTGACAAACGATCGGTACAGTATGGTCGGAGGAAACCTTGTTATCAACAACC

CGGACAAACAGAAAGACGCTGGGGTGTACTACTGCCTGGCATCCAACAACTACGGAATGGTCAGGAGCACGGAGGCAACTCTGAGCTTCGGGT ATCTCG

ACCCCTTTCCTCCCGAGGAGCGTCCGGAAGTGAAGGTGAAGGAAGGGAAGGGCATGGTGCTTCTCTGTGATCCTCCCTACCACTTCCCAG ATGATCTTA

GCTACCGCTGGCTTCTGAATGAATTTCCTGTATTTATCACCATGGATAAGCGAAGATTTGTGTCTCAGACCAACGGCAATCTCTACATCGCAAATGTCGA

GTCTTCTGACAGAGGCAACTACTCCTGCTTTGTGTCCAGTCCTTCTATTACAAAGAGTGTGTTCAGCAAGTTTATTCCCCTCATTCCGATTCCTGAAC G

AACAACAAAGCCATATCCTGCTGATATTGTGGTGCAGTTCAAGGACATATACACCATGATGGGCCAAAATGTGACTTTAGAGTGTTTCGCTCTAGGGAA 

CCCTGTTCCTGATATCCGGTGGCGGAAGGTGCTAGAACCAATGCCCAGCACTGCTGAGATAAGCACGTCAGGGGCTGTCCTCAAGATCTTCAACATCCAG

CTAGAAGATGAAGGCCTCTACGAGTGTGAGGCTGAGAACATCCGGGGAAAGGACAAGCACCAGGCAAGAATCTATGTTCAAG CGTTTCCTGAGTGGGTA

GAGCATATCAATGACACTGAGGTGGACATAGGCAGTGACCTCTACTGGCCTTGCATAGCCACAGGGAAGCCCATTCCTACCATCAGGTGGCTGAAAAATG

GATACTCG TATCACAAAGGGGAACTGAGACTGTATGATGTGACTTTTGAAAATGCCGGGATGTACCAGTGCATAGCAGAAAACGCGTATGGGTCCATTT

ATGCCAACGCTGAGCTCAAGATCCTGG CTTTAGCTCCAACTTTTGAAATGAATCCTATGAAGAAAAAGATCTTGGCTGCGAAAGGTGGAAGGGTTATCA

TTGAATGTAAACCCAAGGCCGCACCAAAACCCAAGTTTTCATGGAGCAAAGGGACGGAGTGGCTCGTTAACAGCAGCAG AATACTCATATGGGAAGATG

GTAGCTTGGAAATCAATAATATTACAAGAAATGATGGTGGAATCTATACATGCTTTGCAGAAAATAACAGAGGAAAAGCTAATAGCACTGGGACTCTGGT

GATCACAA ATCCCACACGAATTATTTTGGCCCCAATCAATGCTGACATCACTGTTGGGGAAAATGCCACCATGCAGTGTGCTGCGTCTTTCGATCCTGC

CTTGGACCTCACGTTTGTGTGGTCCTTCAATGGCTACGTGATTGACTTTAACAAGGAAATTACGCATATCCATTACCAGAGGAATTTTATG CTCGACGC

CAATGGGGAACTGCTCATCCGAAATGCGCAGCTGAAACACGCAGGCCGGTACACGTGCACGGCGCAGACAATCGTGGACAATTCCTCGGCTTCCGCTGAC

CTTGTCGTTCGAG GCCCCCCAGGTCCCCCAGGAGGCCTGAGAATAGAAGACATCAGAGCTACCTCTGTGGCACTGACTTGGAGCCGTGGTTCCGACAAT

CACAGCCCTATCTCTAAATACACGATCCAGACCAAGACGATTCTCTCAGATGACTGGAAAGATGCGAAGACAG ATCCCCCAATCATTGAAGGAAACATG

GAGTCAGCAAAAGCAGTGGATTTGATCCCTTGGATGGAGTATGAATTTCGAGTGGTGGCGACCAATACTTTAGGGACAGGAGAGCCCAGCATACCCTCAA

ACAGGATCAAAACAGACGGTGCTG CACCAAATGTGGCTCCCTCAGATGTAGGCGGTGGGGGCGGAACCAACAGAGAGCTGACAATAACGTGGGCG CCT

TTGTCGAGAGAGTACCATTACGGTAACAATTTTGGTTACATAGTGGCGTTTAAGCCATTTGATGGAGAAGAGTGGAAGAAAGTGACTGTGACTAACCCAG

ACACTGGCCGCTACGTCCACAAAGATGAGACCATGACCCCCTCCACCGCGTTTCAAGTCAAAGTGAAAGCCTTCAACAATAAAGGAGATGGGCCCTACAG

CCTCGTAGCTGTCATCAACTCTGCACAAGATG CTCCCAGTGAAGCCCCCACAGAGGTAGGGGTCAAAGTGTTATCATCCTCTGAGATATCTGTCCATTG

GAAGCATGTGTTAGAGAAAATTGTGGAAAGCTATCAG ATTCGGTACTGGGCTGGGCATGACAAAGAAGCAGCCGCACACAGAGTTCAGGTCACCAGCCA

GGAGTACTCAGCCAGACTGGAGAACCTTCTTCCCGACACCCAGTACTTCATTGAAGTGGGAGCCTGCAACAGTGCCGGATGCGGACCTTCCAGTGATGTG

ATCGAGACCTTCACCAGAAAAGCCC CTCCTAGCCAACCACCAAGGATCATCAGTTCGGTGAGATCTGGCTCACGATATATAATCACATGGGATCACGTT

GTGGCACTATCCAATGAATCTACTGTGACAGGCTACAAG ATACTCTATAGACCGGATGGCCAACATGACGGCAAGCTGTTCTCAACCCATAAACACTCC

ATAGAAGTCCCCATCCCCAGAGACGGAGAGTATGTTGTCGAGGTTCGAGCACACAGCGACGGGGGAGACGGAGTCGTGTCTCAAGTCAAAATTTCAG GC

GTGTCCACGCTGTCTTCGAGTCTCCTCAGCTTGCTCCTGCCCTCCCTTGGCTTTCTTGTCTACTCGGAATTCTGAATGTTACGACCTTGGCTGTTTTCAT

CCCTGCTCAGAGGATGCTCTTCATCATGGGATGACTGTAATTCCTTCTAATCCCTGCGGCTCCATCCTAAGCCAAACAAATTAGACTCTAACAAGCTGTT

CAACTGATTTCCCAACACATCACGACTGAGGCATTCAGGAACCCCTTCATCCAAAAGAATAACTTTCAAGTGGAAATAAAGTGATTTTTAACTCGTTCCA

ATATGCCTTATAAACCATTTAACCTGATTCTGTGAAAGTTGCATGACTTAAATCAATGGACAAGTTACAGTGTTCAATTCAATGCCCTAGGCTGTAGAGT

GAAGGTCACCATACACAGGTGCTTTACATGTTTGACAAGTTGTGAAATATAATAGAGATTGAAATGTTGATTGTATGTAGTATGTGTTCGAGTAATGCAG

TCTCTTGTATTAGCCTATATGTTTGGGTTCCTGCCTATTTTTGAAAGACCCTCATCATTCATGATATTTTGAGTTTTCCATAAAATTAAAACAAAAAAAA

Translation
 - UNI37843 - MKMPLLVSHLLLISLTSCLGD DFTWHRRYGHGV VSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARASPFPVYK KWRMN

NGDVDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATLSFGY YLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPD DDLSYRWLLNE

FPVFITMDKRRFVSQTNGNLYIANVESSDRGNYSCFVSSPSITKSVFSKFIPLIPIPER RTTKPYPADIVVQFKDIYTMMGQNVTLECFALGN NPVPD

IRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDKHQARIYVQA AFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKNGYS

 YHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILA ALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSR RILIWE

DGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITN NPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKEITHIHYQRNFM

 LDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRG GPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTD DP

PIIEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAA APNVAPSDVGGGGGTNRELTITWA PLSREYHYGNNFGYIVAFKPFDGEE

WKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDA APSEAPTEVGVKVLSSSEISVHWKHVLEKIVESYQ IRYWAGHDK

EAAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAP PPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYK ILYRPD

GQHDGKLFSTHKHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISG GVSTLSSSLLSLLLPSLGFLVYSEF
Transcript ENSMUST00000000109
Sequence
AGTCGCCGCTGCCGATTGCTGTGCTCATTAAATTCATTAAGATGTTGAGTGGAGAGATTGCTGAGTGGATAAACTCAGGGAGATGGCCTCGTGGACAAAA

TGTTGCTGCATAAGTGTGGCGCCTATTGCTGGAATCCCCAGTTCCCAG - UNI37843 - GTCTTTCATAGTACTCAACTGCCATAAAGCTTTCATTA

CTTTTGGAAACTGACCCATCTATTCAACAAAAGATGAAAATGCCATTGCTGGTCAGCCATCTCCTGCTAATCTCCTTAACATCTTGTCTAGGAG ACTTT

ACCTGGCACAGAAGATATGGTCATGGAG TGTCTGAGGAGGACAAAGGATTTGGGCCCATTTTTGAAGAGCAGCCAATCAATACCATTTACCCAGAAGAG

TCACTGGAAGGAAAAGTGTCACTCAACTGCCGGGCACGCGCCAGCCCATTTCCAGTTTACAA ATGGAGAATGAATAACGGGGACGTGGACCTGACAAAC

GATCGGTACAGTATGGTCGGAGGAAACCTTGTTATCAACAACCCGGACAAACAGAAAGACGCTGGGGTGTACTACTGCCTGGCATCCAACAACTACGGAA

TGGTCAGGAGCACGGAGGCAACTCTGAGCTTCGGGT ATCTCGACCCCTTTCCTCCCGAGGAGCGTCCGGAAGTGAAGGTGAAGGAAGGGAAGGGCATGG

TGCTTCTCTGTGATCCTCCCTACCACTTCCCAG ATGATCTTAGCTACCGCTGGCTTCTGAATGAATTTCCTGTATTTATCACCATGGATAAGCGAAGAT

TTGTGTCTCAGACCAACGGCAATCTCTACATCGCAAATGTCGAGTCTTCTGACAGAGGCAACTACTCCTGCTTTGTGTCCAGTCCTTCTATTACAAAGAG

TGTGTTCAGCAAGTTTATTCCCCTCATTCCGATTCCTGAAC GAACAACAAAGCCATATCCTGCTGATATTGTGGTGCAGTTCAAGGACATATACACCAT

GATGGGCCAAAATGTGACTTTAGAGTGTTTCGCTCTAGGGAA CCCTGTTCCTGATATCCGGTGGCGGAAGGTGCTAGAACCAATGCCCAGCACTGCTGA

GATAAGCACGTCAGGGGCTGTCCTCAAGATCTTCAACATCCAGCTAGAAGATGAAGGCCTCTACGAGTGTGAGGCTGAGAACATCCGGGGAAAGGACAAG

CACCAGGCAAGAATCTATGTTCAAG CGTTTCCTGAGTGGGTAGAGCATATCAATGACACTGAGGTGGACATAGGCAGTGACCTCTACTGGCCTTGCATA

GCCACAGGGAAGCCCATTCCTACCATCAGGTGGCTGAAAAATGGATACTCG TATCACAAAGGGGAACTGAGACTGTATGATGTGACTTTTGAAAATGCC

GGGATGTACCAGTGCATAGCAGAAAACGCGTATGGGTCCATTTATGCCAACGCTGAGCTCAAGATCCTGG CTTTAGCTCCAACTTTTGAAATGAATCCT

ATGAAGAAAAAGATCTTGGCTGCGAAAGGTGGAAGGGTTATCATTGAATGTAAACCCAAGGCCGCACCAAAACCCAAGTTTTCATGGAGCAAAGGGACGG

AGTGGCTCGTTAACAGCAGCAG AATACTCATATGGGAAGATGGTAGCTTGGAAATCAATAATATTACAAGAAATGATGGTGGAATCTATACATGCTTTG

CAGAAAATAACAGAGGAAAAGCTAATAGCACTGGGACTCTGGTGATCACAA ATCCCACACGAATTATTTTGGCCCCAATCAATGCTGACATCACTGTTG

GGGAAAATGCCACCATGCAGTGTGCTGCGTCTTTCGATCCTGCCTTGGACCTCACGTTTGTGTGGTCCTTCAATGGCTACGTGATTGACTTTAACAAGGA

AATTACGCATATCCATTACCAGAGGAATTTTATG CTCGACGCCAATGGGGAACTGCTCATCCGAAATGCGCAGCTGAAACACGCAGGCCGGTACACGTG

CACGGCGCAGACAATCGTGGACAATTCCTCGGCTTCCGCTGACCTTGTCGTTCGAG GCCCCCCAGGTCCCCCAGGAGGCCTGAGAATAGAAGACATCAG

AGCTACCTCTGTGGCACTGACTTGGAGCCGTGGTTCCGACAATCACAGCCCTATCTCTAAATACACGATCCAGACCAAGACGATTCTCTCAGATGACTGG

AAAGATGCGAAGACAG ATCCCCCAATCATTGAAGGAAACATGGAGTCAGCAAAAGCAGTGGATTTGATCCCTTGGATGGAGTATGAATTTCGAGTGGTG

GCGACCAATACTTTAGGGACAGGAGAGCCCAGCATACCCTCAAACAGGATCAAAACAGACGGTGCTG CACCAAATGTGGCTCCCTCAGATGTAGGCGGT

GGGGGCGGAACCAACAGAGAGCTGACAATAACGTGGGCG CCTTTGTCGAGAGAGTACCATTACGGTAACAATTTTGGTTACATAGTGGCGTTTAAGCCA

TTTGATGGAGAAGAGTGGAAGAAAGTGACTGTGACTAACCCAGACACTGGCCGCTACGTCCACAAAGATGAGACCATGACCCCCTCCACCGCGTTTCAAG

TCAAAGTGAAAGCCTTCAACAATAAAGGAGATGGGCCCTACAGCCTCGTAGCTGTCATCAACTCTGCACAAGATG CTCCCAGTGAAGCCCCCACAGAGG

TAGGGGTCAAAGTGTTATCATCCTCTGAGATATCTGTCCATTGGAAGCATGTGTTAGAGAAAATTGTGGAAAGCTATCAG ATTCGGTACTGGGCTGGGC

ATGACAAAGAAGCAGCCGCACACAGAGTTCAGGTCACCAGCCAGGAGTACTCAGCCAGACTGGAGAACCTTCTTCCCGACACCCAGTACTTCATTGAAGT

GGGAGCCTGCAACAGTGCCGGATGCGGACCTTCCAGTGATGTGATCGAGACCTTCACCAGAAAAGCCC CTCCTAGCCAACCACCAAGGATCATCAGTTC

GGTGAGATCTGGCTCACGATATATAATCACATGGGATCACGTTGTGGCACTATCCAATGAATCTACTGTGACAGGCTACAAG ATACTCTATAGACCGGA

TGGCCAACATGACGGCAAGCTGTTCTCAACCCATAAACACTCCATAGAAGTCCCCATCCCCAGAGACGGAGAGTATGTTGTCGAGGTTCGAGCACACAGC

GACGGGGGAGACGGAGTCGTGTCTCAAGTCAAAATTTCAG GCGTGTCCACGCTGTCTTCGAGTCTCCTCAGCTTGCTCCTGCCCTCCCTTGGCTTTCTT

GTCTACTCGGAATTCTGAATGTTACGACCTTGGCTGTTTTCATCCCTGCTCAGAGGATGCTCTTCATCATGGGATGACTGTAATTCCTTCTAATCCCTGC

GGCTCCATCCTAAGCCAAACAAATTAGACTCTAACAAGCTGTTCAACTGATTTCCCAACACATCACGACTGAGGCATTCAGGAACCCCTTCATCCAAAAG

AATAACTTTCAAGTGGAAATAAAGTGATTTTTAACTCGTTCCAATATGCCTTATAAACCATTTAACCTGATTCTGTGAAAGTTGCATGACTTAAATCAAT

GGACAAGTTACAGTGTTCAATTCAATGCCCTAGGCTGTAGAGTGAAGGTCACCATACACAGGTGCTTTACATGTTTGACAAGTTGTGAAATATAATAGAG

ATTGAAATGTTGATTGTATGTAGTATGTGTTCGAGTAATGCAGTCTCTTGTATTAGCCTATATGTTTGGGTTCCTGCCTATTTTTGAAAGACCCTCATCA

TTCATGATATTTTGAGTTTTCCATAAAATTAAAACAAAAA
Translation
 - UNI37843 - MKMPLLVSHLLLISLTSCLGD DFTWHRRYGHGV VSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARASPFPVYK KWRMN

NGDVDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATLSFGY YLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPD DDLSYRWLLNE

FPVFITMDKRRFVSQTNGNLYIANVESSDRGNYSCFVSSPSITKSVFSKFIPLIPIPER RTTKPYPADIVVQFKDIYTMMGQNVTLECFALGN NPVPD

IRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDKHQARIYVQA AFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKNGYS

 YHKGELRLYDVTFENAGMYQCIAENAYGSIYANAELKILA ALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSR RILIWE

DGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITN NPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKEITHIHYQRNFM

 LDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRG GPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTD DP

PIIEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAA APNVAPSDVGGGGGTNRELTITWA PLSREYHYGNNFGYIVAFKPFDGEE

WKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDA APSEAPTEVGVKVLSSSEISVHWKHVLEKIVESYQ IRYWAGHDK

EAAAHRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAP PPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYK ILYRPD

GQHDGKLFSTHKHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISG GVSTLSSSLLSLLLPSLGFLVYSEF

For any suggestions or comments, please send an email to unitrap@crg.es