Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055053 (Nfic)
Chromosomal location
Chr 10: 80863647 - 80893750 (-)
Description
nuclear factor I/C Gene [Source:MGI (curated);Acc:Nfic-004]
RefSeq_dna
NM_008688 NM_026756 
RefSeq_peptide
NP_032714.1 NP_081032.2 
UniGene
Mm.426936 
MGI
MGI:109591 
Uniprot/SWISSPROT
P70255 
Uniprot/SPTREMBL
Q3UHA6 
Human Ortholog
ENSG00000141905 (NFIC)
Omim not available
UniTrap UNI22236
Vector Insertion
Chr 10: 80872428 - 80883011
Public Clones IST11226D12HMF1 (tigm) IST13909G5 (tigm) IST13155H12 (tigm) IST14775H9 (tigm)
IST13311G7 (tigm) IST12036A7 (tigm) IST14543G12 (tigm) IST14571H1 (tigm)
IST14646H9 (tigm) IST14512B5 (tigm) IST14498E4 (tigm)
Private Clones OST302748 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26446
Vector Insertion
Chr 10: 80871155 - 80872355
Public Clones not available
Private Clones OST117564 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21027
Vector Insertion
Chr 10: 80868834 - 80868960
Public Clones not available
Private Clones OST345542 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33704
Vector Insertion
Chr 10: 80863697 - 80866174
Public Clones IST13962E2 (tigm) IST14158G6 (tigm) IST13801H2 (tigm) IST13633A9 (tigm)
IST10318C2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16523
Vector Insertion
Chr 10: 80863646 - 80863817
Public Clones not available
Private Clones OST459185 (lexicon) OST317055 (lexicon) OST288522 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105319
Sequence
AGTAAGTTCGGCGGCCGCTCGGCCTCTGCGCCTCCGGTGCCAGCGCCCCGGGATGTATTCCTCCCCGCTCTGCCTGACCCAG GATGAGTTCCACCCGTT

CATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGCGCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATG

TCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGG

ACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGCTGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCG

GCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAG

CGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGGCGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACT

TTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTGTGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTG

G - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGTGTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGG

TGACCGGAACCGGACCCAAC - UNI21027 - TTCCCTGCCACGCCCATCCTGCCACAGACAGCCTCCACCTACTTCCCCCATACGGCCATCCGGTAC

CCGCCACATCTCAACCCCCAGGACCCGCTCAAGGATCTGGTGTCCCTGGCCTGTGACCCGGCCACCCAGCAGCCTGGACCG - UNI33704 - CCTGC

TCTCCGCCCGACACGTCCCCTGCAAACAGTCCCTTTGTGGGATTAGGACGGAGGGATCCTCTTGCGGGACAG - UNI16523 - - UNI33704 - T

CCTGGTACCTGGGGTAGCCGAGGTTGCCTTCCCATCCCTCCTTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCAGCCTGCATTTTTGGTGGAAAATTA

GATGGAGTGAGAAGCCCCCTGCGGACTCCCAGCTGGATGGAAAAGACAGGAGGAGAAAAGGACAAAGAC
Translation
MYSSPLCLTQ DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGK

KAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236

 - DAEQSSSPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPN - UNI21027 - FPATPIL

PQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPATQQPGP - UNI33704 - PALRPTRPLQTVPLWD - UNI16523 - - UNI33704 - 
Transcript ENSMUST00000105320
Sequence
AGTAAGTTCGGCGGCCGCTCGGCCTCTGCGCCTCCGGTGCCAGCGCCCCGGGATGTATTCCTCCCCGCTCTGCCTGACCCAG GATGAGTTCCACCCGTT

CATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGCGCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATG

TCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGG

ACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGCTGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCG

GCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAG

CGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGGCGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACT

TTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTGTGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTG

G - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGTGTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGG

TGACCGGAACCGGACCCAACTTCTCACTGGGAGAGCTGCAGGGTCACCTGGCATATGACCTGAACCCGGCCAGCGCCGGCATGAGAAGGACTCTACCCAG

CACCTCCTCCAGTGG GAGCAAGCGGCACAAGTCGGGCTCGATGGAAGAGGACGTGGACACGAGCCCCGGCGGCGACTACTACACGTCGCCCAACTCACC

CACGAGTAGCAGCCGCAACTGGACGGAAGACATAGAAGGAG - UNI21027 - GCATCTCATCCCCGGTGAAGAAGACAGAGATGGACAAATCTCCAT

TCAACAGCCCGTCCCCCCAGGACTCCCCCCGGCTCTCCAGCTTCACACAACACCACAGGCCGGTCATCGCGGTACACAGT - UNI21027 - - UNI3

3704 - CCTGCTCTCCGCCCGACACGTCCCCTGCAAACAGTCCCTTTGTGGGATTAGGACGGAGGGATCCTCTTGCGGGACAG - UNI16523 - - 

UNI33704 - TCCTGGTACCTGGGGTAGCCGAGGTTGCCTTCCCATCCCTCCTTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCAGCCTGCATTTTT

GGTGGAAAATTAGATGGAGTGAGAAGCCCCCTGCGGACTCCCAGCTGGATGGAAAAGACAGGAGGAGAAAAGGACAAAGAC
Translation
MYSSPLCLTQ DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGK

KAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236

 - DAEQSSSPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPNFSLGELQGHLAYDLNPASAGM

RRTLPSTSSSG GSKRHKSGSMEEDVDTSPGGDYYTSPNSPTSSSRNWTEDIEGG - UNI21027 - GISSPVKKTEMDKSPFNSPSPQDSPRLSSFT

QHHRPVIAVHS - UNI21027 - - UNI33704 - PALRPTRPLQTVPLWD - UNI16523 - - UNI33704 - 
Transcript ENSMUST00000078185
Sequence
AGTAAGTTCGGCGGCCGCTCGGCCTCTGCGCCTCCGGTGCCAGCGCCCCGGGATGTATTCCTCCCCGCTCTGCCTGACCCAG GATGAGTTCCACCCGTT

CATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGCGCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATG

TCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGG

ACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGCTGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCG

GCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAG

CGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGGCGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACT

TTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTGTGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTG

G - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGTGTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGG

TGACCGGAACCGGACCCAACTTCTCACTGGGAGAGCTGCAGGGTCACCTGGCATATGACCTGAACCCGGCCAGCGCCGGCATGAGAAGGACTCTACCCAG

CACCTCCTCCAGTGG GAGCAAGCGGCACAAGTCGGGCTCGATGGAAGAGGACGTGGACACGAGCCCCGGCGGCGACTACTACACGTCGCCCAACTCACC

CACGAGTAGCAGCCGCAACTGGACGGAAGACATAGAAGGAG - UNI21027 - GCATCGCGCGGAGCCCCCACCCGACCTCGGCCCTGCACTTCCCTG

CCACGCCCATCCTGCCACAGACAGCCTCCACCTACTTCCCCCATACGGCCATCCGGTACCCGCCACATCTCAACCCCCAGGACCCGCTCAAGGATCTGGT

GTCCCTGGCCTGTGACCCGGCCACCCAGCAGCCTGGACCG - UNI33704 - CCTGCTCTCCGCCCGACACGTCCCCTGCAAACAGTCCCTTTGTGGG

ATTAGGACGGAGGGATCCTCTTGCGGGACAG - UNI16523 - - UNI33704 - TCCTGGTACCTGGGGTAGCCGAGGTTGCCTTCCCATCCCTCC

TTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCAGCCTGCATTTTTGGTGGAAAATTAGATGGAGTGAGAAGCCCCCTGCGGACTCCCAGCTGGATGGA

AAAGACAGGAGGAGAAAAGGACAAAGAC
Translation
MYSSPLCLTQ DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGK

KAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236

 - DAEQSSSPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPNFSLGELQGHLAYDLNPASAGM

RRTLPSTSSSG GSKRHKSGSMEEDVDTSPGGDYYTSPNSPTSSSRNWTEDIEGG - UNI21027 - GIARSPHPTSALHFPATPILPQTASTYFPHT

AIRYPPHLNPQDPLKDLVSLACDPATQQPGP - UNI33704 - PALRPTRPLQTVPLWD - UNI16523 - - UNI33704 - 
Transcript ENSMUST00000020461
Sequence
AGTAAGTTCGGCGGCCGCTCGGCCTCTGCGCCTCCGGTGCCAGCGCCCCGGGATGTATTCCTCCCCGCTCTGCCTGACCCAG GATGAGTTCCACCCGTT

CATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGCGCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATG

TCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGG

ACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGCTGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCG

GCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAG

CGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGGCGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACT

TTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTGTGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTG

G - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGTGTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGG

TGACCGGAACCGGACCCAACTTCTCACTGGGAGAGCTGCAGGGTCACCTGGCATATGACCTGAACCCGGCCAGCGCCGGCATGAGAAGGACTCTACCCAG

CACCTCCTCCAGTGG GAGCAAGCGGCACAAGTCGGGCTCGATGGAAGAGGACGTGGACACGAGCCCCGGCGGCGACTACTACACGTCGCCCAACTCACC

CACGAGTAGCAGCCGCAACTGGACGGAAGACATAGAAGGAG - UNI21027 - GCATCTCATCCCCGGTGAAGAAGACAGAGATGGACAAATCTCCAT

TCAACAGCCCGTCCCCCCAGGACTCCCCCCGGCTCTCCAGCTTCACACAACACCACAGGCCGGTCATCGCGGTACACAGTG GCATCGCGCGGAGCCCCC

ACCCGACCTCGGCCCTGCACTTCCCTGCCACGCCCATCCTGCCACAGACAGCCTCCACCTACTTCCCCCATACGGCCATCCGGTACCCGCCACATCTCAA

CCCCCAGGACCCGCTCAAGGATCTGGTGTCCCTGGCCTGTGACCCGGCCACCCAGCAGCCTGGACCG - UNI33704 - CCTGCTCTCCGCCCGACAC

GTCCCCTGCAAACAGTCCCTTTGTGGGATTAGGACGGAGGGATCCTCTTGCGGGACAG - UNI16523 - - UNI33704 - TCCTGGTACCTGGGG

TAGCCGAGGTTGCCTTCCCATCCCTCCTTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCAGCCTGCATTTTTGGTGGAAAATTAGATGGAGTGAGAAG

CCCCCTGCGGACTCCCAGCTGGATGGAAAAGACAGGAGGAGAAAAGGACAAAGAC
Translation
MYSSPLCLTQ DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGK

KAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236

 - DAEQSSSPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPNFSLGELQGHLAYDLNPASAGM

RRTLPSTSSSG GSKRHKSGSMEEDVDTSPGGDYYTSPNSPTSSSRNWTEDIEGG - UNI21027 - GISSPVKKTEMDKSPFNSPSPQDSPRLSSFT

QHHRPVIAVHSG GIARSPHPTSALHFPATPILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPATQQPGP - UNI33704 - PALRPTRPLQT

VPLWD - UNI16523 - - UNI33704 - 
Transcript ENSMUST00000105321
Sequence
AGTAAGTTCGGCGGCCGCTCGGCCTCTGCGCCTCCGGTGCCAGCGCCCCGGGATGTATTCCTCCCCGCTCTGCCTGACCCAG GATGAGTTCCACCCGTT

CATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGCGCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATG

TCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCAGAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGG

ACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGCTGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCG

GCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCCTGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAG

CGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGGCGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACT

TTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTGTGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTG

G - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGTGTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGG

TGACCGGAACCGGACCCAACTTCTCACTGGGAGAGCTGCAGGGTCACCTGGCATATGACCTGAACCCGGCCAGCGCCGGCATGAGAAGGACTCTACCCAG

CACCTCCTCCAGTGG GAGCAAGCGGCACAAGTCGGGCTCGATGGAAGAGGACGTGGACACGAGCCCCGGCGGCGACTACTACACGTCGCCCAACTCACC

CACGAGTAGCAGCCGCAACTGGACGGAAGACATAGAAGGAG - UNI21027 - GCATCTCATCCCCGGTGAAGAAGACAGAGATGGACAAATCTCCAT

TCAACAGCCCGTCCCCCCAGGACTCCCCCCGGCTCTCCAGCTTCACACAACACCACAGGCCGGTCATCGCGGTACACAGTG GCATCGCGCGGAGCCCCC

ACCCGACCTCGGCCCTGCACTTCCCTGCCACGCCCATCCTGCCACAGACAGCCTCCACCTACTTCCCCCATACGGCCATCCGGTACCCGCCACATCTCAA

CCCCCAGGACCCGCTCAAGGATCTGGTGTCCCTGGCCTGTGACCCGGCCACCCAGCAGCCTGGACCG - UNI16523 - - UNI33704 - TCCTGG

TACCTGGGGTAGCCGAGGTTGCCTTCCCATCCCTCCTTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCAGCCTGCATTTTTGGTGGAAAATTAGATGG

AGTGAGAAGCCCCCTGCGGACTCCCAGCTGGATGGAAAAGACAGGAGGAGAAAAGGACAAAGAC
Translation
MYSSPLCLTQ DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGK

KAPGCVLSNPDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236

 - DAEQSSSPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPNFSLGELQGHLAYDLNPASAGM

RRTLPSTSSSG GSKRHKSGSMEEDVDTSPGGDYYTSPNSPTSSSRNWTEDIEGG - UNI21027 - GISSPVKKTEMDKSPFNSPSPQDSPRLSSFT

QHHRPVIAVHSG GIARSPHPTSALHFPATPILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPATQQPGP - UNI16523 - - UNI33704 

- SWYLG
Transcript ENSMUST00000117966
Sequence
ACGGCGGACTCGCCGCTGGGGATGCAAGCGCGGACACCGGAGCAGCGGCAGCCTCGGTCTGCAGCCGAGGACCGGCCGGAGCGCGGGCTGGGGGGGAAGA

GGCGGCGGGGGGCGGGCCGGGGGAGGGTCCGCGGGCGGGGCGGGCGGCTCCCCACGCGCCTCCCCACGCGCCTCCCCACGCGCCTCCCCGCCGGCCGTCG

CCTCGCCGCACAGCGCCATG GATGAGTTCCACCCGTTCATCGAGGCGCTGCTGCCGCATGTGCGCGCCTTCGCCTACACCTGGTTCAACCTGCAGGCGC

GCAAGCGCAAGTACTTCAAGAAGCACGAGAAGCGCATGTCCAAGGACGAGGAGCGCGCGGTGAAGGATGAGCTGCTGGGTGAAAAGGCCGAAGTGAAGCA

GAAGTGGGCGTCGCGGCTGCTGGCCAAGCTGCGCAAGGACATCCGGCCCGAGTGCCGTGAAGACTTCGTACTGGCTGTGACTGGCAAGAAGGCGCCAGGC

TGTGTGCTGTCCAACCCGGACCAGAAGGGCAAGATGCGGCGCATCGACTGCCTGCGCCAGGCCGACAAAGTGTGGCGTCTGGACCTGGTCATGGTCATCC

TGTTCAAGGGCATCCCACTGGAGAGCACAGATGGTGAGCGGCTGGTGAAGGCGGCTGCCTGTGCGCACCCGGTGCTGTGTGTGCAGCCGCACCATATTGG

CGTGGCCGTCAAGGAGCTGGACCTGTACCTGGCCTACTTTGTGCGGGAGCGCG - UNI22236 - ATGCGGAGCAGAGCAGCAGCCCCCGGACAGGTG

TGGGCTCAGACCAGGAGGACAGCAAGCCCATAACGCTGG - UNI26446 - ACACCACAGACTTCCAGGAGAGCTTTGTCACGTCAGGTGTGTTCAGT

GTCACGGAGCTGATCCAAGTGTCTCGGA CACCTGTGGTGACCGGAACCGGACCCAACTTCTCACTGGGAGAGCTGCAGGGTCACCTGGCATATGACCTG

AACCCGGCCAGCGCCGGCATGAGAAGGACTCTACCCAGCACCTCCTCCAGTGG GAGCAAGCGGCACAAGTCGGGCTCGATGGAAGAGGACGTGGACACG

AGCCCCGGCGGCGACTACTACACGTCGCCCAACTCACCCACGAGTAGCAGCCGCAACTGGACGGAAGACATAGAAGGAG - UNI21027 - GCATCTC

ATCCCCGGTGAAGAAGACAGAGATGGACAAATCTCCATTCAACAGCCCGTCCCCCCAGGACTCCCCCCGGCTCTCCAGCTTCACACAACACCACAGGCCG

GTCATCGCGGTACACAGTG GCATCGCGCGGAGCCCCCACCCGACCTCGGCCCTGCACTTCCCTGCCACGCCCATCCTGCCACAGACAGCCTCCACCTAC

TTCCCCCATACGGCCATCCGGTACCCGCCACATCTCAACCCCCAGGACCCGCTCAAGGATCTGGTGTCCCTGGCCTGTGACCCGGCCACCCAGCAGCCTG

GACCG - UNI33704 - CCTGCTCTCCGCCCGACACGTCCCCTGCAAACAGTCCCTTTGTGGGATTAGGACGGAGGGATCCTCTTGCGGGACAG - U

NI16523 - - UNI33704 - TCCTGGTACCTGGGGTAGCCGAGGTTGCCTTCCCATCCCTCCTTCATCACCGGTGGAGTCCCAGGGTGACAGTCCCA

GCCTGCATTTTTGGTGGAAAATTAGATGGAGTGAGAAGCCCC
Translation
M DEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLRKDIRPECREDFVLAVTGKKAPGCVLSN

PDQKGKMRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLVKAAACAHPVLCVQPHHIGVAVKELDLYLAYFVRERD - UNI22236 - DAEQSS

SPRTGVGSDQEDSKPITLD - UNI26446 - DTTDFQESFVTSGVFSVTELIQVSRT TPVVTGTGPNFSLGELQGHLAYDLNPASAGMRRTLPSTSS

SG GSKRHKSGSMEEDVDTSPGGDYYTSPNSPTSSSRNWTEDIEGG - UNI21027 - GISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAV

HSG GIARSPHPTSALHFPATPILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPATQQPGP - UNI33704 - PALRPTRPLQTVPLWD - U

NI16523 - - UNI33704 - 

For any suggestions or comments, please send an email to unitrap@crg.es