Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000055069 (Rab39)
Chromosomal location
Chr 9: 53492215 - 53514337 (-)
Description
RAB39, member RAS oncogene family Gene [Source:MGI (curated);Acc:Rab39-001]
RefSeq_dna
NM_175562 
RefSeq_peptide
NP_780771.1 
UniGene
Mm.290285 Mm.403787 
MGI
MGI:2442855 
Uniprot/SWISSPROT
Q8BHD0 
Uniprot/SPTREMBL
Q0PD15 Q8BLW7 
Human Ortholog
ENSG00000179331 (RAB39)
Omim not available
UniTrap UNI27998
Vector Insertion
Chr 9: 53494842 - 53513993
Public Clones CMHD-GT_243G11-3 (cmhd) IST12074C7 (tigm)
Private Clones OST42723 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068449
Sequence
AGGCGGCGGCCGCAGCCGCAGGAAGATGCTGGAAGCGGGCGGGCGCGCGCCGCGTAGGTGCTGAAGGGACAGTTCCTTAGGCAGAACTTGCTCCTGAGCG

CACGGGGCACGTAGGCGATGGAGACTATTTGGATCTATCAGTTCCGCCTTATTGTGATCGGAGACTCCACGGTGGGCAAGTCGTGCCTTCTGCACCGCTT

CACCCAGGGCCGCTTCCCAGGGCTGCACTCCCCCGCCTGCGACCCCACAGTCGGCGTGGACTTCTTCTCGCGCCTGCTGGAGATTGAGCCGGGCAAGAGG

ATCAAGCTGCAGCTCTGGGACACGGCGGGGCAGGAGCGCTTCAG - UNI27998 - ATCAATAACTCGATCCTATTACCGCAACTCAGTTGGAGGATT

TTTAGTGTTTGACATTACTAACCGACGGTCTTTTGAACATGTGAAAGATTGGCTAGAAGAAGCAAAAATGCATGTACAGCCTTTTCAGATTGTATTTCTA

CTGGTGGGACATAAATGTGACCTGGCTTCGCAACGCCAGGTTTCAAGGGAAGAAGCTGAAAGACTGTCAACAGACTGTGGAATGAAGTACATAGAGACCT

CAGCCAAGGACGCGACAAACGTTGAAGAGTCCTTTACAATCCTGACAAGAGACATATATGAGCTTATCAAAAAAGGAGAGATTTGTATTCAGGATGGATG

GGAAGGGGTTAAAAGTGGTTTCGTTCCAAATACTGTGCATTCTTCTGAGGAAGCAGTCAAGCCCAGAAAAGAGTGCTTCTGTTGACTTCAACCTGCTGAA

GAACTACCACAGACAGACCGTGCCACTCTGGATAGATGTCAACATTCACAGCAGAATGATGCAGGGAGTGAACGCCCTCAAACATCCAGACCCGTTTCAT

AAGCTGGTGGACACAACACTGTGTCTCACCACTTATACCAACAGGCTGGGTAGTCTGCTAAGTTAGGAGGAAAAGGAGACAACTTTTCTCTTGAAACCAG

GGTCTACAAAATTACATCCATTCTCACTTTGTTAGCATAGAGCTGACCTTAATGTCCAGATATGTCAGTATTTATTATCTTTCTTGACAGCTGAAAATAG

ATTTTTTGTACATATGTAATCCCTCTGAAAAGAATGTATCAGGATTTAGATTCTCCTGGGTTAGCTAGTATTGAATACAAAGTGCACTTGAAGGGCCAAT

GAGGTGACTCACTGGGTAAAGAAGCTTGCCACCAAATCTATAGACTTGAGCTTCATCCCTGGGGCCCGTGTGGTAGAAGGAAAGAACCCACTTCCCTTGA

AGTTGTCCCCAGACCACATGCGCACTGTCATACACATGCACATACAGATACACATGAGCAAGTACAGGCCCATACACTACATAATGGTGAAGATACGTAT

GGTCCAACCTGAAGGCTGTGCCTGTGGCTCAGTGATAGAATGTTCCTTTAGCTCTGAAAACCCAGATCCAATCCCCTGCATCAAAACTAGAGCAGGAAAA

AGGCAGAGTACCTAGAAGCCGTCTTAGAAATACTGACTAGGACTAAAATATAAATTTTCTATTCAAAGAAGCAGAGTTGCCATTCTTGGAACATAATAAG

TTTTATATTCCCCTTGTGTTCCTGGATTTTTTGCTCCTGGAATCTCCACAATTAATAAGGGATGTGAATGTTCAAAGGAGATGCTTTAGGCGAATATTGT

AAGGGAATAAAAAGGATCACTTTATCAAATACTTTGATGTTATAGTACATTGTCCAAATTTAACAATGCATATATACTGACATTTCCAAAGAAAAAAATA

CAGTTTACCTTGAACTACTTTTAAAATTATCAACATACATAGTATTTTTTCCAGATTTCCAAATTATCCCATTTCCAGTAAAAGTGTGGACAAGATGTTC

TGAACAAGAAAAATGGCGTTAGAAACTCGATTTAGCATTCATAATTCATTATATAAACTCATTTGTAGAAGGGAAGATAAAATAGTTAAGTGAATAAAAT

AATGTTCAAGTTCAATTCTTTTTTAAAAAACAATATTATTGTTTTTCTTCTTTACAGATAGTTCTTCTATATAGCTCAGATCCACTTGCCTCAGTCTCCC

AAGTGCTGGATATGTGGCACCATGCCCAGCTCCTTAATTTTTAGCATGGGGGTCAAGACCAGGTCTCACTCTGGGAGGCCTTGTGGACCTCAAACTCAGT

ATGTAGACTCAGCTAGATGTAAACTCAAGAGATCTGCCTGCCTCTGCCTCTGTGTGCTGGGATTCAAGGTTTTAACTTACTGCTTGAACATGCATGGAAA

GGACATTTTATAAGTGTTATATATTTTATAATATGTATACCTGTTCTATGCTATAAATTGCAAAGTGTATCTAACTACCCAATGAAGCTGACTTTTTGAC

ATTGTAAGGCTCTTATTCTTAAACCATAGTAACCTTATGTGTACAAAAAGCAAAATGGTTTAGTGTAAAGAATATTAAGCAAGAAAACAGAGAACATAGC

TCTAAGCTTACCTTTGCTCATTTTTTTTTCTGGTTTATAAAATGAGCCTACCAGACTCATTTATTGAATTCTATGGAGCTATTCTGAAAATCAAGCAAAT

GGTGTTAAAACTATTTGGGTGCAGAAAGCATAATACAAGTGTTTTGCTGGTTCTGGACATGTCCTTATATTTACAATGAAGACAGATTTTCTTGAGTTCT

TTCTTGTTATTTCTGTGTGGAGATACCAGAAGACAGTGTGTGTTTTCACGGACCAGGGGAGCTCTTGGCTGGTGTTTGTCCTCTGTCCTTCTACCTTGAA

CTGCTGCTGAATCACTGCTTCTCTAAAGCATAAACAATAGAGAAGAAAACCCTTGGGAAACTAATTCAACCAAAAAGTTGTATCTGGAAATATTTTGTGC

AACGTTGAAGTAGGTATTTAATTGTATTTTAAAATATAAACACTTGTACATTTTCTAGATTTGTGTATTTTTAATAGTACCCATG
Translation
METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFR - UNI27998 - RSITRSYYRN

SVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEIC

IQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC

For any suggestions or comments, please send an email to unitrap@crg.es